REGD NO. JK––33
THE
JAMMU AND KASHMIR OFFICIAL GAZETTE
Vol. 139]
Srinagar, Thu., the 30th July, 2026/8th Srav., 1948.
[ No. 18
CONTENTS
English
Pages
Vernacular
pages
PART I-A–
Appointments,
promotions,
transfers
and
leave of absence sanctioned by the Governor,
Government and the Ministers ....
PART I-B–
Notifications,
Communiques
and
General
Orders by the Government and the Ministers ....
PART II-A– Appointments,
promotions,
transfers
and
leave of absence sanctioned by Heads of
Departments ....
PART II- B– Notifications, Notices and Orders by Heads
of
Departments,
Provincial
Heads,
Magistrates and other officers competent to
issue public notices under any law or rule ....
PART II-C–
Notifications, Notices and Orders by Election
Commission of India, Chief Electoral Officer,
Jammu and Kashmir and other Officers of the
Department,
Election
Petitions
and
Judgements of Election Tribunal ....
PART III–
Laws,
Regulations
and
Rules
passed
thereunder ....
PART IV–
Reprints from the Government of India Gazette
or Gazettes of others Governments....
PART V–
Information and Statistics ....
(a) Rates and prices in the State....
(b) Rates and wages ....
(c) Crop Report and Forecasts ....
(d) Whether Observations ....
(e) Vital Statistics ....
SUPPLEMENT-A– Trade
Monthly Imports and Exports from the
State ....
SUPPLEMENT-B– Police ....
SUPPLEMENT-C– Advertisements
....
182-184
117-120
4335-4564
61-64
Printed at the Government Press, Srinagar.
182 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
PART I-A
Jammu & Kashmir Government–Orders
_________
HIGH COURT OF JAMMU & KASHMIR AND LADAKH AT JAMMU
(Exercising powers of Bar Council under Section 58 of the Advocates
Act, 1961)
Notification
No. 896 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Mr. Najeeb UI Rahman S/o Ab. Rahman Wagay
R/o Pati Akhran, Tehsil Devsar, District Kulgam vide Notification
No. 2061 of 2025/RG/LP dated 18.06.2025 has been declared as
Absolute/Final.
By order.
———
Notification
No. 897 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Mr. Mir Moin Ul Islam S/o Iftikhar Ahmed Mir
R/o Mir Pora Chareel Tehsil Banihal, District Ramban vide Notification
No. 2915 of 2025/RG/LP dated 11.09.2025 has been declared as
Absolute/Final.
By order.
———
Notification
No. 898 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Mr. Muneer Ahmad Akhoon S/o Ghulam Ahmad
Akhoon R/o Wathpara, Pandrethan Tehsil Pantha Chowk District Srinagar
vide Notification No. 3593 of 2025/RG/LP dated 14.11.2025 has been
declared as Absolute/Final.
By order.
———
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
183
Notification
No. 899 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Ms. Malik Zainab D/o Mohd Shafi Malik
R/o Khacharpora Baghat (Jehangir Colony-Ext), Tehsil Chanapora
Natipora, District Srinagar vide Notification No. 2909 of 2025/RG/LP
dated 11.09.2025 has been declared as Absolute/Final.
By order.
———
Notification
No. 731 of 2026/RG/LP Dated : 06-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Mr. Mir Mohsin Abbas S/o Nasir Ali Mir R/o Mir
Mohalla Balhama Tehsil Pantha-Chowk District Srinagar vide
Notification No. 3950 of 2025/RG/LP dated 31.12.2025 has been declared
as Absolute/Final.
By order.
———
Notification
No. 901 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Ms. Nighat Rashid D/o Abdul Rashid Rather
R/o Hardushoora, Gubar Mohalla Tehsil Kunzer District Baramulla
vide Notification No. 2563 of 2023/RG/LP dated 09.11.2023 has been
declared as Absolute/Final.
By order.
–––––
Notification
No. 902 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Ms. Nadiya Ayaz D/o Mohammad Ayaz Teli
R/o Wayil Teli Mohalla, Tehsil & District Ganderbal vide Notification
No. 626/2022 dated 27.05.2022 has been declared as Absolute/Final.
By order.
———
184 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
Notification
No. 903 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Mr. Nahin Manzoor S/o Manzoor Hussain R/o Lal
Mandi Wazir Bagh, Tehsil & District Srinagar vide Notification No. 2351
of 2025/RG/LP dated 19.07.2025 has been declared as Absolute/Final.
By order.
———
Notification
No. 904 of 2026/RG/LP Dated : 09-04-2026
Provisional admission as an Advocate, granted under the Advocates
Act, 1961 in favour of Ms. Nuzhat Nabi D/o Ghulam Nabi Najar
R/o Wajhama Handwara Tehsil Kralgund District Kupwara vide
Notification No. 3067 of 2024/RG/LP dated 13.12.2024 has been declared
as Absolute/Final.
By order.
Sd/-
SYED MUJTABA HUSSAIN,
Registrar Administration.
—————————————————————————————
Vol. 139 Srinagar, Thu., the 30th July, 2026/8th Srav., 1948.
[No. 18
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
OFFICE OF THE
COMMISSIONER FOOD AND DRUGS ADMINISTRATION
DRUG AND FOOD CONTROL ORGANIZATION, J&K.
Subject :—Prohibition
on
manufacture,
storage,
transportation,
distribution, and sale of food products containing tobacco
and/or nicotine as ingredients, including gutkha, pan masala,
and products sold separately but intended for mixing, in the
Union Territory of Jammu and Kashmir for a period of one
year with effect from 06-2026.
–——
Order No. 157-FDA of 2026
Dated 16.06.2026
Whereas, Regulation 2.3.4 of the Food Safety and Standards
(Prohibition and Restrictions on sales) Regulations, 2011 prohibits the
use of tobacco and nicotine as ingredients in any food products, as they
are injurious to health ; and
Whereas, food is defined in section 3 (1) (j) of Food Safety and
Standards Act 2006 ; as any substance, whether processed, partially
processed or unprocessed, which is intended for human consumption and
118
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
includes primarily food to the extent defined in clause (zk), genetically
modified or engineered food or food containing such ingredients, infant
foods, packaged drinking water, alcoholic drink, chewing gum, and any
substance, including water used to into the food during its manufacture,
preparation or treatment but does not include any animal feed, live
animals unless they are prepared or processed for placing on the market
for human consumption, plants, prior to harvesting, drugs and medicinal
products, cosmetics, narcotic or psychotropic substances ; and
Whereas, food products containing tobacco and/or nicotine as
ingredients, including Gutkha, Pan Masala and other chewable food
products by whatever name called, are widely available in the market and
their consumption poses serious health risks to the general public,
particularly school-going children, adolescents, young adults and
labourers, the continued manufacture, storage, transportation, distribution
and sale of such products is prejudicial to public health and is likely to
adversely affect the well-being of present and future generations, thereby
necessitating prohibition thereof in the Union Territory of Jammu &
Kashmir in the interest of public health; and
Whereas, the Hon’ble Supreme Court of India, in Central Arecanut
Marketing Corporation & Ors. v. Union of India (Transfer Case
(Civil) No. 1 of 2010), vide order dated 23.09.2016, observed that
manufacturers, in order to circumvent the ban on Gutkha, were selling
pan masala (without tobacco) along with flavoured chewing tobacco in
separate sachets, often conjointly and through the same vendors, thereby
enabling consumers to mix and consume the same as Gutkha ;
Whereas, the Hon'ble Supreme Court, taking note of such practices,
directed all concerned statutory authorities to ensure strict compliance
with Regulation 2.3.4 of the Food Safety and Standards (Prohibition and
Restrictions on Sales) Regulations, 2011, and further directed the
Secretaries of Health Departments of all States/Union Territories to
ensure effective enforcement of the ban on manufacture and sale of
Gutkha and pan masala containing tobacco and/or nicotine;
Whereas, in compliance with the aforesaid directions, the Food
Safety and Standards Authority of India (FSSAI), vide communications
dated 05.10.2016 and 09.10.2017 (File No. 13(25)/2017/Tobacco
Issues/RCD/FSSAI), and the Department of Health & Family Welfare,
Government of India, vide D.O. letter No. 16019/21/2014-PH-H dated
05.12.2016, reiterated the prohibition under Regulation 2.3.4, which inter
alia prohibits manufacture, storage, transport, distribution or sale of all
food products, whether chewable or otherwise, which are flavoured,
scented or mixed with tobacco and/or nicotine, including products sold in
separate packages but intended for mixing by the consumer ;
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
119
Whereas, it has been specifically clarified that such prohibition
extends to all products, by whatever name called, whether packaged or
unpackaged, and whether sold as a single product or as separate
components facilitating easy mixing for consumption;
Whereas, it has further been observed by the Government of India,
vide D.O. letter dated 24.10.2025 issued by the Additional Secretary, that
several States/UTs have not been issuing or renewing the requisite
orders/notifications under Section 30(2) (a) of the Food Safety and
Standards Act, 2006 on an annual basis, thereby adversely affecting
effective enforcement of the said prohibition;
Whereas, the Food Safety and Standards Authority of India has
again emphasized upon all Commissioners of Food Safety of States/UTs
to ensure strict compliance with the directions of the Hon'ble Supreme
Court dated 23.09.2016 and to issue/renew appropriate orders under
Section 30(2)(a) of the Food Safety and Standards Act, 2006, on an
annual basis, prohibiting the manufacture, storage, distribution and sale
of Gutkha and pan masala containing tobacco and/or nicotine, including
products marketed separately but intended to be consumed together;
Whereas, the Commissioner of Food Safety, after recording the
reasons herein, is satisfied that in the interest of public health, it is
necessary to prohibit the manufacture, storage, transportation,
distribution, and sale of all food products containing tobacco and/or
nicotine as ingredients, including gutkha, pan masala, and any products
sold separately but intended to be mixed for consumption;
Now, therefore, in exercise of the powers conferred under clauses
(a) and (b) of sub-section (2) of Section 30 of the Food Safety and
Standards Act, 2006 (34 of 2006), I, Khalid Jahangir, Commissioner of
Food Safety, Union Territory of Jammu & Kashmir, do hereby prohibit
and order that no person shall manufacture, store, transport, distribute, or
sell any food product that contains tobacco and/or nicotine as an
ingredient. This prohibition applies to, but is not limited to :—
• Gutkha containing tobacco/nicotine ;
• Pan masala containing tobacco/nicotine;
• Any
chewable
or
flavoured
food
product
containing
tobacco/nicotine;
• Any chewable or flavoured food product containing tobacco/
nicotine, whether sold as a single product or in separate packages
intended to be mixed for consumption.
This order shall remain in force throughout the Union Territory of
Jammu and Kashmir for a period of one year from June 2026.
120
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
The Food Safety Officers and other authorities under the Food
Safety and Standards Act, 2006, shall ensure strict compliance with this
order. Any violation shall be liable for penal action under the provisions
of the Food Safety and Standards Act, 2006.
Sd/-
KHALID JAHANGIR, JKAS,
Commissioner,
Food and Drugs Administration,
J&K.
—————————————————————————————
Vol. 139 Srinagar, Thu., the 30th July, 2026/8th Srav., 1948.
[No. 18
PART II—B
Notifications, Notices and Orders by the Heads of Departments.
———
IN THE COURT OF JUDICIAL MAGISTRATE 1ST CLASS
CHARAR-I-SHARIEF
CNR JKBG080002942025
File No. 31/2025
Date of Institution 29.12.2025
Date of Order 20.06.2026
Manzoor Ahmad Thokar S/o Abdul Gani Thokar
R/o Kakawring CG, Dhar Tehsil Charar-I-Sharief
District Budgam (J&K)
(Complainant)
Through Adv. Ashiq Baba
Versus
Khalid Rashid S/o Abdul Rashid Khirka
R/o Nafulteng, Charar-I-Sharief
Tehsil Charar-I-Sharief District Budgam (J&K)
(Accused Person)
Through Adv. Reyaz Ahmad
4336 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
In the matter of :— Complaint in terms of Section 138 read with Section
142 of Negotiable Instruments Act.
Present : Aiman Amin
JO CODE : JK00324
1. The instant complaint under Section 138 NI Act is pending
disposal before this court since December 2025. Perusal of the record
reveals that the accused has repeatedly remained absent. Eventually
warrants came to be issued consistently, and the report has been filed by
Taameeli that accused could not be found at his residential house and has
left the jurisdiction of this court. The said report was taken on record
with the warrants. Statement of Tameeli concerned was also recorded
on 20.06.2026 and made part of record.
2. Therefore, in view of this factual background of the case it
appears that the accused is will fully avoiding the arrest and execution of
processes of this court. Hence this court deems it appropriate now to
proceed under Section 84 of BNSS by issuance of proclamation against
the accused, which shall be published as per the mandate of law as
follows:
(i) It shall be publicly read in some conspicuous place of the town
or village in which the accused ordinarily resides ;
(ii) It shall be affixed to some conspicuous part of the house or
homestead in which the accused ordinarily resides or to some
conspicuous part of such town or village; and
(iii) A copy thereof shall be affixed to some conspicuous part of the
Court-complex ;
(iv) Further in the interests of justice let the said proclamation be
also published in any local daily newspaper circulating in the
place in which such person ordinarily resides, at the expense of
the complainant.
3. Let the said proclamation which shall be annexed with this court
order be published in the manner aforesaid by the SHO concerned of the
area where the accused ordinarily resides who shall report the proof of
said proclamation having been published in the manner aforesaid with
specific date before this court by or before 20.07.2026.
4. As far as publication in newspaper is concerned, the complainant
also shall ensure that same is done positively before 20.07.2026 and shall
report compliance on the said date.
5. The accused shall accordingly appear before this court on the date
mentioned in the proclamation order.
6. Copy of this order along with the proclamation order shall be
provided to the SHO concerned (Charar-I-Sharief through SP Budgam),
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4337
via prosecution to report compliance by or before 20.07.2026. positively
who shall also be present before the court to state that such publication
has been duly done. A Copy of this order shall also go to SP Budgam for
information and necessary action. List again on 20.07.2026 for reporting
compliance.
Announced : 20.06.2026
Sd/-
Judicial Magistrate 1st Class,
(Charar-I-Sharief).
———
IN THE COURT OF JUDICIAL MAGISTRATE 1ST CLASS
CHARAR-I-SHARIEF
CNR JKBG080002942025
File No. 31/2025
Date of Institution 29.12.2025
Date of Order 20.06.2026
Manzoor Ahmad Thokar S/o Abdul Gani Thokar
R/o Kakawring CG, Dhar Tehsil Charar-I-Sharief
District Budgam (J&K)
(Complainant)
Versus
Khalid Rashid S/o Abdul Rashid Khirka
R/o Nafulteng, Charar-I-Sharief
Tehsil Charar-I-Sharief District Budgam (J&K)
(Accused Person)
In the matter of :— Complaint in terms of Section 138 read with
Section 142 of Negotiable Instruments Act.
Present : Aiman Amin
JO CODE : JK00324
Proclamation Requiring the Appearance of Accused
Whereas a complaint under Section 138 N.I. Act has been presented
in this Court on 29.12.2025 stating that the accused person namely
Khalid Rashid S/o Abdul Rashid Khirka R/o Nafulteng Charar-I-Sharief
Tehsil Charar-I-Sharief District Budgam (J&K) has committed the
offence under Section 138 N.I. Act and it has been returned to a warrant
of arrest thereupon issued that the said accused cannot be found and
whereas it has been shown to the satisfaction of this court that the said
accused person has concealed himself in order to avoid the service of
warrants.
4338 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
Proclamation is hereby made that the accused person namely Khalid
Rashid S/o Abdul Rashid Khirka R/o Nafulteng Charar-I-Sharief Tehsil
Charar-I-Sharief District Budgam (J&K) is required to appear before me
i.e., at Court of Judicial Magistrate 1st Class Charar-I-Sharief to answer
the said complaint on 20/07/2026.
Given under my hand and seal of the Court on 20th day of
June, 2026.
Announced : 20.06.2026
Sd/-
Judicial Magistrate 1st Class,
(Charar-I-Sharief).
———
IN THE COURT OF CHIEF JUDICIAL MAGISTRATE, SHOPIAN
General Warrant of Arrest under Section 335 of the BNSS
In the case of :—
UT of J&K through Police Station Shopian. FIR No. 33 of 2026.
Offences. u/sec. 179, 180, 318(2), 318(3), 61 & 238 BNS
Vs.
Mohd Syed Wani and Ors.
Order
Whereas information and material have been placed before this
Court in connection with FIR No. 33 of 2026, disclosing the commission
of offences punishable under Sections 179, 180, 318(2), 318(3), 61 &
238 of the Bharatiya Nyaya Sanhita, 2023, and wherein accused Jayar
Ali Sheikh, S/o Barkat Sheikh, resident of Chapra, Subash Pally,
District Nadia, West Bengal-741123 & accused Dilshada Begum
W/o Ahammed Dar, residing at C/o Ahammed Dar, Bangaljhi,
Chapra, District Nadia, West Bengal-741123 have been arrayed as
accused persons.
And whereas the record placed before the Court reveals that despite
repeated and sincere efforts undertaken by the Investigating Agency to
apprehend the aforesaid accused persons, they have failed to make
themselves available to the investigation and have deliberately evaded
arrest ; and whereas the Investigating Agency has reported that the
accused persons are absconding and that, despite due diligence and
genuine efforts, there is presently no immediate likelihood of securing
their arrest through ordinary process of law. That upon consideration of
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4339
the material available on record, this Court is satisfied that the accused
persons are intentionally avoiding arrest and that coercive measures are
warranted to secure their presence before the Court and to ensure the
proper administration of justice and proceedings under section 335 of the
BNSS have been initiated against the aforesaid accused persons.
Therefore, in exercise of the powers conferred under section 335 of
BNSS, this Court hereby authorizes & directs the Senior Superintendent
of Police, Shopian, the concerned Station House Officer, and all Police
Officers within the Union Territory of Jammu and Kashmir, as well as
any other police officer legally empowered in this behalf, to arrest the
aforesaid accused persons wherever they may be found and to produce
them before the competent Court without unnecessary delay and in
accordance with law.
This General Warrant of Arrest shall remain in force until the
accused persons are apprehended and produced before the Court, or until
further orders are passed by a competent Court. It is further ordered that
a copy of this warrant be published in the Official Gazette for
information of the general public and for facilitating the arrest of the
aforesaid accused persons. It is further ordered that a copy of this warrant
be forwarded to the Senior Superintendent of Police having jurisdiction
over the area in which the accused persons ordinarily reside, for
necessary action and execution of the warrant. The concerned police
authorities shall take all lawful and effective measures to apprehend the
accused persons and ensure their production before the competent Court
at the earliest. Copy of this warrant be sent to concerned SSP for arrest of
accused in whose jurisdiction they reside. Accordingly, the warrant be
issued.
Announced.
Sd/-
Chief Judicial Magistrate,
Shopian.
———
IN THE COURT OF SPECIAL JUDGE
(Designated under NDPS Act) ANANTNAG
Present : Imran Hussain Wani
UT of J&K through SHO, P/S Anantnag
FIR No. 107/2026 Offences U/S 8/20-29 NDPS Act
Versus
Faizan Ahmad Lone & ors.
(Accused)
4340 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
In the matter of :— General Warrant of Arrest against accused person
namely Gowhar Ahmad Reshi S/o Gh. Mohi-Ud-Din
Reshi R/o Mir Dantar.
The DIG,
South Kashmir
Whereas this court by order date 12.06.2026 has proceeded against
accused Gowhar Ahmad Reshi in terms of section 512 CrPC and has
directed to issue a General Warrant of arrest against the said accused in
terms of said section.
You are therefore, authorized and required to arrest the accused
above named wherever he is found in UT of J&K and Ladakh and to
produce him before this Court as soon as practicable.
Given under my hand and seal of the Court on this the 12th day of
June 2026.
Sd/-
Special Judge,
(Designated under NDPS Act),
Anantnag.
———
IN THE COURT OF SUB JUDGE/SPECIAL MOBILE MAGISTRATE,
UDHAMPUR
UT of J&K through SHO P/S Udhampur.
Vs.
Adil Ahmed S/o Mashkoor Ahmed R/o Brandi Devgham, Anantnag.
General Warrant of Arrest U/S 299 Cr.P.C
Whereas Accused namely Adil Ahmed S/o Mashkoor Ahmed
R/o Brandi Devgham Anantnag stands charged with the offence of
279/337/338 RPC in FIR No. 475/2018 P/S Udhampur and the said
accused has been absconding since long. Hence through the medium of
this General Warrant of Arrest. You are hereby authorized and directed
to arrest the said accused and produce him before the Court as and when
arrested. This warrant shall remain in force till the arrest of the accused.
Given under the seal and signature of the undersigned today
on 29.05.2026.
Sd/-
Sub Judge
Special Mobile Magistrate,
Udhampur.
———
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4341
OFFICE OF THE STATE TAX OFFICER CIRCLE –‘P’, JAMMU.
EXCISE & TAXATION COMPLEX, PANAMA CHOWK,
JAMMU-180019.
Notification
It has been reported by M/s Anjani Putter Enterprises, Opp.
Gurudwara, Jeevan Nagar Jammu. Having Tin. 01741201509 that
C-Forms (02 Nos) Two bearing S. No. 04v-892286 to 04v-892287 &
VAT-65 Forms (02 Nos) Two bearing S. No. 0451639 to 0451643 have
been lost and matter stands published in below mentioned Newspaper for
declaring them invalid:-
1. The News now.
2. Jammu Kashmir Kesari.
That dealer has also furnished an indemnity bond in this respect,
which is placed on record. Hence, the below noted c-Forms Form are
hereby declared as invalid for the purpose under sub-section (4) of
section of the CST Act, 1956. Anybody, fraudulently using the said C-
forms Forms will render himself liable for penalty action as per Law.
The person/s who will find the said C-Forms Forms please return the
same to the undersigned
3. VAT-65 Forms (02 Nos) Two bearing S. No. 0451639
to 0451643
4. C-Forms (02 Nos) Two bearing S. No. 04v-892286 to
04v-892287.
Name & Address of the dealer. M/s Anjani Putter Enterprises, Opp.
Gurudwara, Jeevan Nagar Jammu.
Lost/Stolen/Destroyed : Lost.
Registration Number
: ΤΙΝ. 01161201343
To whom issued
: M/s
Anjani
Putter
Enterprises,
Opp.
Gurudwara, Jeevan Nagar, Jammu.
No. 125-28/STO/P
Date : 20/08/2026
Sd/-
Assessing Authority, State Tax Officer,
Circle-‘P’, Jammu.
———
4342 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
OFFICE OF THE STATE TAX OFFICER CIRCLE –‘P’, JAMMU.
EXCISE & TAXATION COMPLEX, PANAMA CHOWK,
JAMMU-180019.
Notification
It has been reported by M/s Mahalakshmi Pharmaceuticals, Sanjay
Nagar Jammu. Having Tin. 01711040845 that C-Forms (10 Nos) Ten
bearing S. No. 05v-465622 to 05v-465631 and VAT-65 Forms (20 Nos)
Twenty bearing S. No. 0826045 to 0826064 have been lost and matter
stands published in below mentioned Newspaper for declaring them
invalid :—
1. Daily Excelsior
2. State Times
That dealer has also furnished an indemnity bond in this respect,
which is placed on record. Hence, the below noted c-Forms Form are
hereby declared as invalid for the purpose under sub-section (4) of
section of the CST Act, 1956. Anybody, fraudulently using the said
C-forms and VAT-65 Forms will render himself liable for penalty action
as per Law. The person/s who will find the said C-Forms and VAT-65
Forms please return the same to the undersigned
3. C-Forms (10) Ten Form from S. No. 05v-465622 to 05v-465631.
4. VAT-65 Forms (20 Nos) Twenty Form S. No. 0826045 to
0826064.
Name & Address of the dealer : M/s
Mahalakshmi
Pharmaceuticals,
Sanjay Nagar, Jammu.
Lost/Stolen/Destroyed
: Lost.
Registration Number
: ΤΙΝ. 01711040845
To whom issued
: M/s
Mahalakshmi
Pharmaceuticals,
Sanjay Nagar, Jammu.
No. 142-44/STO/P
Date : 01/07/2026
Sd/-
Assessing Authority, State Tax Officer,
Circle-‘P’, Jammu.
———
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4343
GOVERNMENT OF JAMMU AND KASHMIR
OFFICE OF THE DEPUTY COMMISSIONER, REASI
MINI SECRETARIAT, DISTRICT ADMINISTRATIVE COMPLEX,
REASI-182311 (J&K) INDIA.
Subject :—De-notification of land measuring 05 Kanals 17 Marlas
bearing Khasra No. 2131/624min (00K-18M) & 2131/624min
(04K-19M) situated in village Sarh, Tehsil Mahore, District
Reasi.
———
De-notification No. 11-DC(Rsi) of 2026
Dated: 12-06-2026
Whereas, the land measuring 418 Kanals 02 Marlas (local) situated
in village Sarh, Tehsil Mahore, District Reasi was required for public
purpose
namely
Construction/Upgradation
of
Budhal-Mahore-
Gool(BMG) road to NHDL Specification including land measuring 05
Kanals 17 Marlas bearing Khasra No.2131/624min(00K-18M) &
2131/624min(04K-19M) ; and
Whereas, on the receipt of indent from indenting department i.e.
Officer Commanding 100 RCC (GREF) C/O 56 APO and
recommendation of Collector Land Acquisition (Sub Divisional
Magistrate) Mahore vide No.SDM/M/2022-23/42-45 dated 06.04.2022,
sanction was accorded vide No. DC/Rsi/SQ/22-23/343-47 dated 16-04-
2022 to the exemption from undertaking Social Impact Assessment
Study under section 9 by invoking urgency clause under section 40 of the
Right to Fair Compensation and Transparency in Land Acquisition,
Rehabilitation and Resettlement Act, 2013 for the subject land ; and
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore vide No. CLA/SDM/M/2022-23/66-81 dated 18-05-2022 issued
preliminary notification under section 11(1) of the (RFCTLARR) Act,
2013 for calling upon the objections, if any, from the interested
persons/land owners within stipulated time period from the date of
issuance/ publication of the said notice ; and
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore vide No. CLA/SDM/M/2022-23/576-78 dated 28-02-2023
requested the appropriate Government i.e. Deputy Commissioner, Reasi
to issue declaration under section 19(1) of RFCTLARR Act, 2013 ; and
Whereas, the appropriate Government i.e Deputy Commissioner
Reasi was pleased to issue declaration under section 19 (1) of the ibid
Act vide notification No. 10-DC (Rsi) of 2023 dated: 19-04-2023 issued
under endorsement No. DC/Rsi/SQ/23-24/401-08 dated 19-04-2023 for
4344 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
land measuring 418 Kanals 02 Marlas local situated at village
Sarh,
Tehsil
Mahore,
District
Reasi
for
public
purpose
namely “Construction/improvement of Budhal-Mahore-Gool GREF
road ; and
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore issued notification under section 21 of RFCTLARR Act, 2013
vide No. CLA/SDM/M/2023-24/193-208 Dated 20-06-2023 asking all
the
stakeholders/land
owners/interested
persons
to
file
their
objections/attend his office either in person or through an authorized
agent or advocate within 35 days from the date of publication of the
notice, in which large number of objections/claims were received in
response to the above quoted notification dated 20-06-2023. The matter
was examined in light of the available record and subsequent verification
by various commissions constituted by District Collector Reasi. Based on
verification reports, necessary amendments were incorporated in the
acquisition proceedings. However, issuance of award was withheld in
view of indenting department's request for de-scoping of certain stretches
of land; and
Whereas, the indenting department again requested Collector Land
Acquisition (Sub Divisional Magistrate) Mahore vide No.800/EPC/PKG-
11/36/E2 dated 20-12-2025 for further proceedings after receipt of
administrative approval for de-scoping of the land/location in respect of
village Sarh, Tehsil Mahore, District Reasi: and
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore requested the appropriate Government to de-scope the land
measuring 05 Kanals 17 Marlas (local) at village Sarh, Tehsil Mahore
from the scope of the project which was no longer required for the
intended public purpose namely "Construction/upgradation of
Budhai-Mahore-Gool (BMG) GREF road" at village Sarh, Tehsil
Mahore, District Reasi ; and
Whereas, in the intervening period of approval of de-scoping sought
by GREF from their competent authority and disposal of the objections
raised by the land owners against notification issued under section 21,
the stipulated time period for one year from the issuance of Notification
under section 19(1) had lapsed under section 25 of the ibid Act ; and
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore vide No. CLA/SDM/M/2025-26/585-87 dated 25-11-2025
requested District Collector, Reasi for extension of time period for
issuance of award in respect of village Sarh, Tehsil Mahore, in
response to which appropriate Government vide No. DC/Rsi/SQ/25-
26/4531-34 dated 16-01-2026 extended the time period for one year
w.e.f.16-01-2026 for the issuance of final award ; and
No. 18]
The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4345
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore vide No. CLA/SDM/M/2025-26/476-78 Dated 04-02-2026
requested the appropriate Government for accord of approval for De-
notification of land measuring 05 Kanals 17 Marlas as notified under
section 11, section 19 and section 21 of the RFCTLARR Act 2013; and
Whereas, Section 93 of the Right to Fair Compensation and
Transparency in Land Acquisition, Rehabilitation and Resettlement Act,
2013 provides that:
“Completion of acquisition not compulsory, but compensation
to be awarded when not completed :—
(I) The appropriate Government shall be at liberty to withdraw
from the acquisition of any land of which possession has not
been taken.
(II) Whenever the appropriate Government withdraws from any
such acquisition, the Collector shall determine the amount of
compensation due for the damage suffered by the owner in
consequence of the notice or of any proceedings thereunder,
and shall pay such amount to the person interested, together
with all costs reasonably incurred by him in the prosecution of
the proceedings under this Act relating to the said land".
Whereas, the appropriate Government vide No.DC/Rsi/SQ/25-
26/5490-91 dated 11-03-2026 again requested Collector Land
Acquisition (Sub Divisional Magistrate) Mahore to furnish comments in
light of Section 93 sub section (2) of RFCTLARR Act, 2013, in response
to which Collector Land Acquisition (Sub Divisional Magistrate) Mahore
vide No. CLA/SDM/M/2025-26/575-77 dated 20-03-2026 furnished his
comments. The detailed response/comments of Collector Land
Acquisition (Sub Divisional Magistrate) Mahore were examined,
the appropriate Government vide letter No.DC/Rsi/SQ/26-27/15-16
(E-7596931) Dated 02-04-2026 accorded approval for de-notification of
land measuring 05 Kanals 17 Marlas notified under section 11, 19 and 21
of the Act ; and
Whereas, Collector Land Acquisition (Sub Divisional Magistrate)
Mahore vide Letter No. CLA/SDM/M/2026-27/105-07 dated 15-04-2026
and No. CLA/SDM/M/2026-27/210 dated 02-06-2026 has now requested
for issuance of withdrawal notification/de-notification order for item
No.223 and 224 for land measuring 05 Kanals 17 Marlas bearing Khasra
No.2131/624min(00K-189M) and 2131/624min(04K-19M) situated in
village Sarh, Tehsil Mahore, District Reasi in notification No.10-DC
(Rsi) of 2023 dated 19-04-2023 issued under endorsement No.
DC/Rsi/SQ/23-24/401-08 dated 19-04-2023 for land measuring 418
4346 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948.
[No. 18
Kanals 02 Marlas local situated at village Sarh, Tehsil Mahore, District
Reasi for public purpose namely “Construction/improvement of
Budhal-Mahore-Gool GREF road”;
Now, therefore, in terms of sub-section (1) of Section 93 of the
Right to Fair Compensation and Transparency in Land Acquisition,
Rehabilitation and Resettlement Act, 2013, land measuring 05
Kanals 17 Marlas bearing Khasra No.2131/624min(00K-189M) and
2131/624min (04K-19M) situated in Village Sarh, Tehsil Mahore,
District Reasi, shall and shall always be deemed to have been de-notified
from the acquisition proceedings issued by the Collector Land
Acquisition (Sub Divisional Magistrate) Mahore, subject to the condition
that:
a. The Collector Land Acquisition (Sub Divisional Magistrate)
Mahore shall ensure that the possession of the said land has not
been taken by the indenting department/agency and the land
was/is still in the continued physical possession of the land
owner(s).
b. The compensation of the said land has not been paid to the
rightful claimants and if any compensation received by the land
owner(s) in respect of the said land shall be recovered back
before effecting necessary changes in the revenue records in
pursuance of the proposed de-notification.
c. The Collector Land Acquisition (Sub Divisional Magistrate)
Mahore shall ensure that the said land has not been proposed
for any other acquisition/public purpose or is likely to be
required.
d. The proposed de-notification shall be without prejudice to the
outcome of the writ petition(s), if any, pending consideration
before the Competent Court (s).
The particulars of the land de-notified are as under :—
S.
No.
Name of Village/
Tehsil
Khasra No.
Area under
acquisition
K
M
1.
Sarh/Mahore
2131/624min
00
18
2.
2131/624min
04
19
Total
05
17
Sd/-
KUMAR ABHISHEK, IAS,
Deputy Commissioner,
Reasi.
———
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4347
NOTIFICATION
In my Aadhaar Card bearing Aadhaar No. 5196 1429 3395 my name
& parentage has been enrolled as Abdul Rahim Magray S/o Ghulam
Mohammad Magray instead of Abdul Rehim Magray S/o Ghulam Mohd
Magray. Now, I want to apply for it's Correction.
Abdul Rehim Magray S/o Ghulam Mohd Magray
R/o Heewan, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
Inadvertently my name in my Aadhaar has been mentioned as Aadil
Ahmad Bhat instead of Shabir Ahmad Bhat. Now, I want to rectify the
same.
Shabir Ahmad Bhat S/o Manzoor Ahmad Bhat
R/o Ward No 03, Bandipora.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4348 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Ghulam Mohi ud din Mir S/o Ghulam Ahmad Mir R/o Batpora,
Magam, P/o Handwara, District Kupwara, J&K applying for correction of
my name which is wrongly written as Gulam Mohiuddin instead of the
correct name which is Ghulam Mohi ud din Mir, in Demat A/c bearing
Demat A/c No. 10356708 with JKBFSL having DP ID (IN302349). Now,
I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar record bearing Aadhaar No. 2925 9152 9464 my ward’s
name and DoB is recorded as Saboora Manzoor and DoB 04-04-2006
instead of Zainab Manzoor and DoB 12-06-2006. It needs correction.
Zainab Manzoor D/o Manzoor Ahmad Bhat
R/o Paniwah, Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4349
NOTIFICATION
I, Hajra Begum W/o Ghulam Mohamad Shah R/o Qasba Lar,
Ganderbal hereby declare that my name has been incorrectly recorded as
Hajira Begum in my Aadhaar Card bearing No. 6783-6169-3161. My
correct and actual name is Hajra Begum. Both names refer to one and the
same person. Henceforth, I shall be known and identified by the name
Hajra Begum for all official, legal, and administrative purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammad Arif Doie F/o Rifat Jan R/o Gund Sarsingh, Tehsil
Gund, District Ganderbal want to inform that Aadhaar No. of my daughter
is 7938 5515 6685. That due to an inadvertent error her name has been
wrongly recorded in Aadhaar Card as Rifata Jan. That her correct and
actual name is Rifat Jan which is reflected in her other valid documents.
That both the names mentioned above refer to one and the same person,
i.e., my daughter. That I request the concerned authorities to
update/correct her name in Aadhaar records from Rifata Jan to Rifat Jan.
Mohammad Arif Doie F/o Rifat Jan
R/o Gund Sarsingh, Tehsil Gund, District Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4350 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Parvaiz Ahmad Bokda F/o Sumayah Parvaiz R/o Sumbal Bala,
Tehsil Gund, District Ganderbal want to inform that Aadhaar No. of my
daughter is 6588 6970 0474. That due to an inadvertent error her name has
been wrongly recorded in Aadhaar Card as Samiya. That her correct and
actual name is Sumayah Parvaiz which is reflected in her other valid
documents. Now, I request the concerned authorities to update/ correct her
name in Aadhaar records from Samiya to Sumayah Parvaiz.
Parvaiz Ahmad Bokda F/o Sumayah Parvaiz
R/o Sumbal Bala, Tehsil Gund, District Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Ishtiyaq Ahmad Gojar Awan S/o Mohd Yousuf Awan R/o Sango
Pati Mamer, Tehsil Kangan, District Ganderbal affirm that my Aadhaar
No. is 9102 3418 8868. That due to an inadvertent error my name has been
wrongly recorded in Aadhaar Card as Mohd Ishtaq Gojar Awan. That my
correct and actual name is Ishtiyaq Ahmad Gojar Awan, which is reflected
in my other valid documents. That both the names mentioned above refer
to one and the same person, ie., myself. That I request the concerned
authorities to update/correct my name in Aadhaar records from Mohd
Ishtaq Gojar Awan to Ishtiyaq Ahmad Gojar Awan.
Ishtiyaq Ahmad Gojar Awan S/o Mohd Yousuf Awan
R/o Sango Pati Mamer, Tehsil Kangan, District Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4351
NOTIFICATION
I, Zabir Ahmad Paswal F/o Aarif Ahmad Paswal R/o Fraw Haknar,
Tehsil Gund, District Ganderbal want to inform that my son is the holder
of Aadhaar Card bearing No. 5915 0512 3222 issued by UIDAI. That as
per records available with UIDAI my son's name is incorrectly mentioned
as Imran Ahmad Paswal That as per the DoB certificate issued by the
concerned authority my son's name is Aarif Ahmad Paswal. Now, I am
applying for the correction of same.
Zabir Ahmad Paswal F/o Aarif Ahmad Paswal
R/o Fraw Haknar, Tehsil Gund, District Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In my Aadhaar Card bearing No. 2394 3258 3731 my name has been
wrongly admitted as Ammarah Jan while as my actual name is Gulshan
Bano. Now, I am applying for its correction.
Gulshan Bano W/o Manzoor Ahmad Ghari
R/o Tengpora Byepass, Batamaloo, Near New City Hospital,
Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4352 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Shamas Din Khan F/o Insha Bano R/o Rayil, Tehsil Gund, District
Ganderbal want to inform that my daughter is the holder of Aadhaar Card
bearing No. 2357 0131 2395 issued by UIDAI. That as per records
available with UIDAI my daughter's name is incorrectly mentioned as
Imsha Bano. However as per the school records my daughter's actual name
is Insha Bano. Now, I am applying for correction of same.
Shamas Din Khan, F/o Insha Bano
R/o Rayil, Tehsil Gund, District Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Javid Ahmad Dar F/o Sufiya Javid R/o Aglar Chirat, Tehsil
Zainpora, District Shopian do hereby inform the general public that my
ward’s name & parentage has been wrongly mentioned in his Aadhaar
Card as Sufaya Javaid & Javaid Ahmad Dar respectively. That the correct
and actual name & parentage is Sufiya Javid & Javid Ahmad Dar
respectively.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4353
NOTIFICATION
It is information to the general public that my name in my Aadhaar
Card has been wrongly entered as Shazahda W/o Mohd Maqbool Wagay
while my correct name is Shahzada W/o Mohammad Maqbool Wagay.
Now, I want the same to be corrected.
Shahzada W/o Mohammad Maqbool Wagay
R/o Wagay Mohallah, Bijbehara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammad Arif Chichi F/o Arizoo Arif R/o Wudder Kangan want
to inform that Aadhaar No. of my daughter is 8696 1868 4516. That due
to an inadvertent error her name has been wrongly recorded in Aadhaar
Card as Aarzoo Arif. That her correct and actual name is Arizoo Arif,
which is reflected in her other valid documents. That both the names
mentioned above refer to one and the same person, i.e., my daughter. That
I request the concerned authorities to update/correct my name in Aadhaar
records from Aarzoo Arif to Arizoo Arif.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4354 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
My name was wrongly mentioned in Aadhaar Card as Magray Junaid
instead of Junaid Mushtaq. Now, I want to change it.
Junaid Mushtaq S/o Mushtaq Ahmad Magray
R/o Kadipora, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In my Aadhaar Card bearing Aadhaar No. 5748 7282 8572 my name
has been enrolled as Arshid Ahmad Rather instead of Ausheed Ahmad
Rather. Now, I want to apply for its correction.
Ausheed Ahmad Rather S/o Mohammad Ashraf Rather
R/o Khaitangan, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4355
NOTIFICATION
It is informed to the general public my name was wrongly mentioned
in Aadhaar Card Vide No. 9280 4818 3298 as Layqat Ali Khan instead of
Liaqate Ali Khan. Now, I want to correct it.
Liaqate Ali Khan S/o Mohd Shafi Khan
R/o Kunderdhan, Chassana, Reasi
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is informed to the general public my name was wrongly mentioned
in Aadhaar Card Vide No. 7569 3648 6766 as Salochna Devi instead of
Sunita Devi. Now, I want to correct it.
Sunita Devi W/o Chankar Singh
R/o Chassana, Reasi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4356 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Sham Lal father and natural guardian of Master Kanhaiya Sharma
R/o Village Paroh, SMVDU, Katra, District Reasi, 182301 hereby declare
that my son's correct name is Kanhaiya Sharma instead of Kaneya Sharma
as appearing in his Aadhaar card. Henceforth, he shall be known as
Kanhaiya Sharma for all official and legal purposes. I am applying for
correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Virinder Anand father and natural guardian of Miss Sargam Anand,
resident of Village Kotla, SMVDU, Katra, Distt. Reasi 182320, hereby
declare that my Daughter's correct name is Sargam Anand instead of
Sargam as appearing in her Aadhaar card. Henceforth, she shall be known
as Sargam Anand for all official and legal purposes. I am applying for
correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4357
NOTIFICATION
It is informed to the general public my son’s name was wrongly
mentioned in Aadhaar Card Vide No. 8747 6217 1596 as Sejaid Ahmed
instead of Sajad Ahmed. Now, I want to correct it.
Shakeel Ahmed F/o Sajad Ahmed
R/o Chandialkote, Reasi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Chelo Devi W/o Chuni Lal R/o Viilage Darore, SMVDU, Kakriyal,
Katra, District Reasi hereby declare that my name has been incorrectly
recorded as Shillo Devi in my Aadhaar card. My correct name is Chelo
Devi. Henceforth, I shall be known and identified by the name Chelo Devi
for all purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4358 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is to notify for general public that I, Garo Devi W/o Sh. Krishan
Lal R/o Chak Largan, Bain Bajalta, Jammu, UT of J&K am applying for
correction of my name inadvertently/incorrectly written as Pooja Devi in
my Aadhaar Card to Garo Devi as per my Domicile Certificate.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, hereby apply for correction of my Aadhaar Card bearing No. 3038
4556 3568 from Kaisar Ahmad Malla to Kysir Bashir.
Kysir Bashir S/o Bashir Ahmad Malla
R/o Sheikh Pora, Haril, Qalamabad, Kupwara, J&K, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4359
NOTIFICATION
I, Jyoti Devi W/o Mohinder Sharma R/o Village Khanna Chargal,
Jammu, J&K, UT state that my name has been wrongly written as Joyti
Devi instead of Jyoti Devi in my Aadhaar Card bearing No. 9460 9044
5336. Now, I am applying for correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is informed to the general public my name was wrongly mentioned
in Aadhaar Card Vide No. 4722 2944 0871 as Darjit Begum instead of
Chanchala Devi. Now, I want to correct it.
Chanchala Devi W/o Naseeb Singh
R/o Tuli, Chassana, Reasi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4360 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I have changed my name from (old name) Abdul Ahad Bhat to (New
name) Ab Ahad Bhat on my Pan card bearing No. IWNPB1184F, also my
actual parentage and DoB is Assad Bhat and 01-01-1941 instead of
Asadullah Bhat and 03-01-1949. Now, I am applying for its correction.
Ab Ahad Bhat S/o Assad Bhat
R/o Hathlangoo, Sopore, District Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I hereby want to apply for correction of my Aadhaar Card bearing
Aadhaar No. 2733 8700 0449 from Sahreefa Begum to Sharafa Bano.
Now, I am applying for its correction.
Sharafa Bano W/o Mohammad Yaseen Ganie
R/o Sanzipora Kutlari, Qalamabad, Kupwara, J&K, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4361
NOTIFICATION
I hereby apply for correction of my Aadhaar Card bearing No. 2744
8090 4360 from Farhat Ayoub to Farhad Ayoob Ganie.
Farhad Ayoob Ganie S/o Mohmad Ayoob Ganie
R/o Sadura Gund, Langate, Kupwara, Jammu and Kashmir, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I hereby apply for correction of my Aadhaar Card bearing No. 4228
5981 7737 from Nelofir Bashir to Neelofar Bashir.
Neelofar Bashir S/o Bashir Ahmad Dar
R/o Kohru, Langate, Kupwara, Jammu and Kashmir, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4362 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I hereby apply for correction of my Son’s Aadhaar Card bearing No.
2676 5692 8772 from Hazim Imtiyaz to Mohammad Muzamil Lone.
Mohammad Muzamil Lone S/o Imtiyaz Ahmad Lone
R/o Nutnussa, Handwara, Kupwara, Jammu and Kashmir, 193221.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I hereby apply for correction of my daughter’s Aadhaar Card bearing
No. 5026 69135652 from Aisha Rameez to Aayesha Rameez.
Aayesha Rameez D/o Rameez Ahmad Dantoo
R/o Bunagam, Langate, Kupwara, Jammu and Kashmir, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4363
NOTIFICATION
I hereby apply for correction of my Aadhaar Card bearing No. 8922
4140 6460 from Gh Qadir Sheikh to Mudasir Ahmad Sheikh.
Mudasir Ahmad Sheikh S/o Abdul Ahad Sheikh
R/o Poshwan, Zachaldara, Kupwara, Jammu and Kashmir, 193221.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I hereby apply for correction of my Aadhaar Card bearing No. 9032
4558 3616 from Surray Mushtaq to Surraya Mushtaq.
Surraya Mushtaq D/o Mushtaq Ahmad Dar
R/o Haran Maidani Chugal, Handwara, Kupwara, J&K, 193221.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4364 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
In Aadhaar bearing No. 6071 7580 7777 my name has been wrongly
mentioned as Farhan Jan while as correct name is Farhet Rafiq D/o
Mohammad Rafiq Mir R/o Nandimarg Tehsil D.H. Pora, District Kulgam.
Now, I want to correct the same.
Farhet Rafiq D/o Mohammad Rafiq Mir
R/o Nandimarg, Tehsil D.H. Pora, District Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of the general public that my name &
DoB in my Aadhaar Card has been wrongly entered as Johra Bano & DoB
as 20-04-1976 while my correct name & DoB is Jawahira Akhter & DoB
is 20-04-1970. Now, I want the same to be corrected.
Jawahira Akhter C/o Mohammad Iqbal Reshi
R/o 187, Lessu Brannar Larnoo, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4365
NOTIFICATION
I, Miss Seerat Naz D/o Mr. Rafeeq Ahmad R/o Kaloosa, Nathpora,
Post Office Bandipora, Tehsil Bandipora, District Bandipora, J&K-
193502 do hereby notify the general public that due to an inadvertent error,
my name and residential address have been incorrectly recorded in my
Aadhaar Card bearing Aadhaar No. 2861 7286 6843 as Scerat Naaz D/o
Rafiq Ahmad Malla R/o Ayatmulla, Anayat Pora (Khar Pora), District
Bandipora, Jammu & Kashmir-193502. However, the correct particulars
as per my Domicile Certificate are Seerat Naz D/o Rafeeq Ahmad R/o
Kaloosa, Nathpora, Post Office Bandipora, Tehsil Bandipora, District
Bandipora, Jammu & Kashmir - 193502.
Seerat Naz.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar bearing No. 3694 4741 1619 my name has been wrongly
mentioned as Sahaib S/o Gazala Gulzar while as my correct name is
Suhaib Gulzar S/o Gulzar Ahmad Sofi R/o Lari, Tehsil Boniyar, District
Baramulla. Now, I want to correct the same.
Suhaib Gulzar S/o Gulzar Ahmad Sofi
R/o Lari, Tehsil Boniyar, District Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4366 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct my name in my Aadhaar Card bearing Aadhaar No.
6075 0964 3322 from Amir Saleem Khan to Aamel Saleem Khan. Now, I
am applying for its correction.
Aamel Saleem Khan S/o Mohammad Saleem Khan
R/o Peerniya.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct my name and DoB in my Aadhaar Card bearing
Aadhaar No. 6829 3800 9657 from Kalu Bajar Gujjar & DoB 01-01-1996
instead of Kalu Gugar S/o Matta Gugar & DoB 12-11-1996. Now, I am
applying for its correction.
Kalu Gugar S/o Matta Gugar
R/o Chotali, Boniyar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4367
NOTIFICATION
I, Shri Ajay Kumar S/o Late Dina Nath R/o Kothey Chanana Camp,
PO Arnia, Tehsil Arnia, District Jammu, UT of J&K being the natural and
lawful father and guardian of my minor son hereby declare that his name
has been changed from Nihaan to Ayaan Singh Randhawa. Henceforth, he
shall be known by the name Ayaan Singh Randhawa for all official and
legal purposes.
Shri Ajay Kumar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform general public that my ward’s name has been
wrongly mentioned in his/her Aadhar records as Afsar khan instead of
Mohammad Afsar khan bearing Aadhaar No. 5692 5178 9875. Now, I am
applying for its correction.
Rafiq Ahmad khan F/o Mohammad Afsar khan.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4368 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is to inform the general public that my ward’s name has been
wrongly mentioned in his/her Aadhar records as Rahat khan instead of
Mohammad Rahat khan bearing Aadhaar No. 7556 6671 2020.
Rafiq Ahmad khan F/o Mohammad Rahat khan.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Suriya Ayoub D/o Mohammad Ayoub Bhat R/o Malgonipora
holding Aadhaar No. 9021 0101 4382 hereby declare that my name has
been incorrectly recorded as Suriya Ayoub in my Aadhaar Card. My
correct name as recorded in my Matriculation Certificate and other
educational documents is Suraiya Ayoub. I, hereby state that Suriya
Ayoub and Suraiya Ayoub refer to one and the same person. I am
publishing this notice to declare that my correct and official name is
Suraiya Ayoub. I am applying for correction of my name in my Aadhaar
Card to bring it in conformity with my Matriculation Certificate and other
official records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4369
NOTIFICATION
I want to correct the name in my daughter's Aadhaar Card bearing No.
7446 3281 5590 from Zubaida Bilal to Zubeeda Bilal. Now, I am applying
for this correction.
Bilal Ahmad Bhat F/o Zubeeda Bilal
R/o Bicherwara, Tehsil Kralgund, District Kupwara, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
My name and DoB was wrongly mentioned in Aadhaar Card as Haji
Abdul Wahab Dar and DoB 06-11-1945 instead of Abdul Wahab Dar and
DoB 06-10-1945 as per matriculation certificate. Now, I want its
correction.
Abdul Wahab Dar S/o Khazir Mohammad Dar
R/o Gund Fatehpora, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4370 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
It is notified for the information of the general public that my name in
my Aadhaar Card has been wrongly entered as Ab Rashid Shiekh while
my correct name is Ab Rashid Sheikh. Now, I want the same to be
corrected.
Ab Rashid Sheikh S/o Gh Mohi Ud Din Sheikh
R/o Mir Danter, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of the general public that my name in
my Aadhaar Card has been wrongly entered as Mursaleen Sartaj S/o Sartaj
Ahmad Mir R/o Bongam, Bulbul Nowgam, Anantnag while my correct
name is Mursaleen Ahmad Mir S/o Sartaj Ahmad Mir R/o Bongam,
Bulbul Nowgam, Anantnag. Now, I want the same to be corrected.
Mursaleen Ahmad Mir S/o Sartaj Ahmad Mir
R/o Bongam, Bulbul Nowgam, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4371
NOTIFICATION
It is notified for the information of the general public that my name in
my Aadhaar Card has been wrongly entered as Shamima Αkhter while my
correct name is Shoby Jan. Now, I want the same to be corrected.
Shoby Jan W/o Bashir Ahmad Bhat
R/o Ruhoo, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of the general public that my name in
my Aadhaar Card has been wrongly entered as Asif Ahmad Baba S/o
Mohd Shafi Baba R/o Brinty Batpora, Anantnag while my correct name is
Aasif Shafi Baba S/o Mohd Shafi Baba R/o Mir Mohalla, Achabal,
Anantnag. Now, I want the same to be corrected.
Aasif Shafi Baba S/o Mohd Shafi Baba
R/o Mir Mohalla, Achabal, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4372 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Aisha Kouser D/o Hamid Ullah Khan R/o Harni, Tehsil Mendhar,
District Poonch want to apply for correction of my name and DoB and
declare that my name is incorrectly mentioned as Ashia Kouser and DoB
as 04-11-2002 instead of correct name Aisha Kouser and correct DoB as
04-11-2001 in my Aadhaar Card bearing No. 8677 1199 2984. Now, I am
applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Safina Bi W/o Abdul Hamid R/o Kasblari, Tehsil Mankote, District
Poonch want to apply for correction of my name and declare that my name
is incorrectly mentioned as Safia Bi Instead of Safina Bi in my Aadhaar
Card bearing No. 3006 6158 9144. Hence Safina Bi is my correct name
and will be used for all future references and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4373
NOTIFICATION
I, Arshad Bi W/o Mohd Rashid and R/o Salani, Uchhad, Tehsil
Mankote, District Poonch want to apply for correction of my name and
declare that my name is incorrectly mentioned as Irshad Bi instead of
Arshad Bi in my Aadhaar Card bearing No. 2850 2714 4464. Hence
Arshad Bi is my correct name and will be used for all future references
and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sajid Ahmed S/o Mohd Iqbal R/o Darhal, District Rajouri, bearing
Aadhaar Card No. 9284 2734 2625 have applied for correction of my name
in Aadhar Card from Sajid Mohammad Iqbal Malik to Sajid Ahmed. Now,
I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4374 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Zafar Iqbal S/o Abdul Majeed R/o Balnoi, Sagra, Tehsil Mankote,
District Poonch want to apply for correction of my name and declare that
my name is incorrectly mentioned as Zaffer Iqbal instead of Zafar Iqbal in
my Aadhaar Card bearing No. 5298 8308 4223. Hence Zafar Iqbal is my
correct name and will be used for all future references and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Dinesh Kumar Sharma S/o Late Sh. Madan Lal R/o H.No. Ep 589,
Peer Mitha, Jammu, P/O Jammu, District Jammu applying for correction
of my name which is wrongly written as Dinesh Sharma instead of correct
as Dinesh Kumar Sharma in my bank account bearing No.
0076040100014939 J&K Bank Residency Road Jammu.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4375
NOTIFICATION
I, Riyaz Ahmed S/o Khizar Mohammad R/o Behrote, Tehsil Thanna
Mandi, District Rajouri applying for correction of my mother’s name &
DoB Which is wrongly written as Rahmat Bibi and DoB 01-07-1950
instead of correct Ramit Begum and DoB is 01-07-1950 in her Aadhaar
Card bearing No. 8607 2823 6323.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Jaiwanti Devi W/o Bharat Thakur R/o Ward No. 49, Near Ravi Dass
Mandir, Channi Rama Jammu, Tehsil & District Jammu Applying for
correction of my name which is wrongly mentioned as Jaywanti Devi
instead of correct name is Jaiwanti Devi in my Aadhaar Card bearing No.
2275 8124 5861.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4376 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Kulmesh Kumari W/o Ramesh Singh R/o Naryana (Khour), Tehsil
Khour, District Jammu applying for correction of my name which is
wrongly written as Kamlesh Kumari instead of correct Kulmesh Kumari
in my Aadhaar Card.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Asha Gupta W/o Shri Ashok Kumar Gupta R/o W. No. 5, Barrian
Udhampur, Tehsil & District Udhampur applying for correction of my
father’s name and my DoB which is wrongly mentioned as Bansi Lal
instead of correct Bansi Lal Gupta and my DoB as 24-07-1958 instead of
24-07-1957 in my Pan Card No. AAXPG2943B.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4377
NOTIFICATION
I, Rajnee Devi W/o Sunil Singh R/o Shaldan Damote, Tehsil and
District Ramban declare that I have applied for correction of my
daughter’s Aadhaar name which has wrongly been recorded as Namdita
Rajput whileas the actual name as per record is Nandita Rajput. Now, I am
applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Amina Begum W/o Mohd Ibrahim R/o Bhangara, Tehsil Pogal
Paristan, Ukhral, District Ramban declare that I have applied for
correction of my Aadhaar name which has wrongly been recorded as
Shadreena Banoo whileas the actual name as per record is Amina Begum.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4378 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Sumitra Devi W/o Jameet Singh R/o Sumber, Tehsil and District
Ramban declare that I have applied for correction of my Aadhaar name
which has wrongly been recorded as Samitra Devi whileas the actual name
as per record is Sumitra Devi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
name is wrongly written as Mohammad Haneef Sheikh S/o Abdul Aziz
Sheikh instead of Hanif Sheik S/o Aziz Sheikh. Now, I want to apply for
its correction.
Hanif Sheik S/o Aziz Sheikh
R/o Dildar, Karnah, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4379
NOTIFICATION
The name of my son has been wrongly mentioned in his Aadhaar card
bearing Aadhaar No. 6385 7527 2551 as Ahtisham Ul Haq instead of
Hasnain Sohail. Now, I am applying for its correction.
Sohail Ahmad Dar F/o Hasnain Sohail
R/o Arwah, Tehsil Beerwah, District Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Atiqa Banoo W/o Abdul Majeed Rather R/o Karihama hereby
declare that my name has been wrongly mentioned as Ateeqa Bagum in
Aadhaar records whileas the correct name is Atiqa Banoo. Now, I am
applying for correction in the Aadhaar Card record’s accordingly.
Atiqa Banoo W/o Abdul Majeed Rather
R/o Karihama, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4380 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is informed to the general public that that my name Snober
W/o Manzoor Ahmad Sheikh D/o Gh Rasool Nath R/o Meej Pampore is
wrongly recorded on J&K Bank FDR B/u Namblabal Pampore bearing
A/c No. 0475050300005089 and the name Suriya Manzoor D/o Gh Rasool
Nath R/o Lalpora Chatlam appearing on J&K Bank Passbook B/u
Drangbal Pampore bearing A/c No. 0016040100026607 which is correct
and both belongs to one and the same person. In furture all the refrences
should be made to Suriya Manzoor D/o Gh Rasool Nath instead of Snober
W/o Manzoor Ahmad Sheikh.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my daughter bearing No. 6535 4686 0948 her
name has been enrolled as Rafta Lateef instead of Rifat Bano. Now, I want
to apply for its Correction.
Lateef Ahmad Sheikh
R/o Heewan, Narvaw, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4381
NOTIFICATION
This is an information for general public that in Aadhaar Card of my
daughter namely Falak Lateef Mir bearing No. 5763 7489 5850 her DoB
has been mistakenly mentioned as 08-02-2011 while as her actual and
correct DoB as per her school records and Birth certificate is 03-03-2014.
Now, I want to apply for its correction.
Tahira Begum W/o Mohammad Lateef Mir M/o Falak Lateef Mir
R/o Quilmuqam, Tehsil Aloosa, District Bandipora,
J&K, India, ΡinCode 193502.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to change my Ward’s credentials in his Aadhaar Card bearing
No. 4240 5371 5160 from Iqbal Ahmad Kachra S/o Rafiq Ahmad Teedwa,
DoB 04-06-2017 R/o More Koot, Kalrooch to Mohammad Iqbal Teedwa
S/o Mohd Rafiq Teedwa, DoB 25-01-2019 R/o Narikoot, Kalarooch.
Now, I am applying for its Correction.
Mohd Rafiq Teedwa F/o Mohammad Iqbal Teedwa DoB 25-01-2019
R/o Narikoot, Kalarooch.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4382 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct the name in my Aadhaar Card bearing No. 4451 5548
7487 from Riffat Shabir to Ruheena Akhter. Now, I am applying for this
correction.
Ruheena Akhter D/o Mohammad Jamal Sheikh
R/o Manzpora, Tehsil Qalmabad, District Kupwara, 193302.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct the name of my daughter in her Aadhaar Card bearing
No. 9926 7870 4978 from Safila Jan to Safila Yousuf as per my school
records. Now, the same is to be corrected.
Muhammad Yousuf Bhat F/o Safila Yousuf
R/o Lalpora, Pampore, Pulwama.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4383
NOTIFICATION
I want to correct my name in my Aadhaar Card bearing No. 7525 3306
0324 from Jahangir Ahmad Wani to Jahangir Gul as per my school
record’s. Now, the same is to be corrected.
Jahangir Gul S/o Ghulam Mohammad Wani
R/o Zewan, Panthachowk, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Zubaida Akhtar D/o Sonaullah Pir R/o Kal Mona, Kupwara do
hereby declare that my name has been wrongly mentioned as Zubeeda
Begum in Aadhaar records. The correct name is Zubaida Akhtar. Now, I
am applying for correction in the Aadhaar Card records accordingly.
Zubaida Akhtar D/o Sonaullah Pir
R/o Kal Mona, Kupwara, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4384 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is to inform the general public that my ward's Name, Parentage
& DoB has been wrongly mentioned in her Aadhaar Card as Razia Bano
D/o Mohd Sultan Lone, DoB 01-06-2003 instead of Raziya Akhter D/o
Muhammad Sultan lone, DoB 10-03-2002. Now, I am applying for its
correction.
Muhammad Sultan Lone F/o Raziya Akhter
R/o Banday Mohalla, Khanti Pora, Tehsil Lalpora, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to Correct my Aadhaar Card name bearing No. 6067 2167 9158
from Wasee Akhter D/o Mohd Shafi Bhat, DoB 04-03-2003 R/o
Kalaroose, Kupwara to Wasia Akhter D/o Mohmad Shafi Bhat, DoB
06-03-2006 R/o Kalaroos, Kupwara. Now, I am applying for the
Correction.
Wasia Akhter D/o Mohmad Shafi Bhat, DoB 06-03-2006
R/o Kalaroos, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4385
NOTIFICATION
I, Abdul Majeed Sheikh F/o Tabish Majeed R/o Waisa Kawnar hereby
declare that my daughter's name has been wrongly mentioned as Tabusha
Bano in Aadhaar records. The correct name is Tabish Majeed. Now, I am
applying for correction in the Aadhaar Card records accordingly.
Abdul Majeed Sheikh F/o Tabish Majeed
R/o Waisa Kawnar, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform general public that I Shameema Bano W/o Fasil
Nawaz Gujjar Bajard R/o Nachiyan, Karnah, Kupwara do hereby declare
that my name has been wrongly mentioned as Shamama Bano in Aadhaar
records whileas the correct name is Shameema Bano. Now, I am applying
for correction in Aadhaar Card records accodingly.
Shameema Bano W/o Fasil Nawaz Gujjar Bajard
R/o Nachiyan, Karnah, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4386 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct my name and parentage in Aadhaar Card under No.
6562 6969 6050 from Afaan Ahmad Afgan S/o Amjad Khan Afgan to
Afnan Khan S/o Amjid Khan. Now, I am applying for its correction.
Afnan Khan S/o Amjid Khan
R/o Uranbua, Tehsil Uri.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Raqiyya Bi W/o Mohd Sadeeq R/o Thera, Tehsil Mendhar, District
Poonch want to apply for correction of my name and declare That my
name is incorrectly mentioned as Roqiyyah Bi instead of Raqiyya Bi in
my Aadhaar Card bearing No. 9659 6616 9538. Hence Raqiyya Bi is my
correct name and will be used for all future references and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4387
NOTIFICATION
I, Bandhana Sharma W/o Sh. Uttam Chand R/o Village Ward No 9,
Lohara (Panjgrian), P/o Dhok Khalsa, Tehsil Jourian, District Jammu have
applied for entering the name of my son namely Kayrav and DoB as
01-12-2019 in his Aadhaar Card bearing No. 2056 1983 7349.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Nazir Ahmed S/o Gh Mohd R/o Shadole, Tehsil Mahore, District
Reasi declare that the deponent is the maternal uncle of girl namely
Simmah Akhter D/o Mushtaq Ahmed in school record. That her name has
been wrongly written in her Aadhaar Card (Under Aadhar Card No. 5906
4246 8029) as Saimmah Akhter D/o Mushtaq Ahmed instead of correct
name Simmah Akhter D/o Mushtaq Ahmed. Now, I am applying for
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4388 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct the name of my daughter in Aadhaar Card bearing
No. 8572 7560 1090 from Raiba Jan to Rabiya Jan. Now, I am applying
for its correction.
Bashir Ahmad Hajam F/o Rabiya Jan
R/o Darpora, Nandimarg, District Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Khursheed Bano D/o Abdul Aziz W/o Abdul Rashid R/o Village
Maswah, Tehsil Gool, District Ramban, Jammu & Kashmir hereby declare
that my name has been incorrectly recorded as Khurshad Begum in my
Aadhaar Card bearing Aadhaar No. 8573 6362 3252 whereas my correct
and actual name is Khursheed Bano. Both the names Khurshad Begum and
Khursheed Bano refer to one and the same person. Henceforth, I shall be
known and identified by the name Khursheed Bano for all purposes and I
request all concerned authorities to treat Khursheed Bano as my correct
name in all present and future records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4389
NOTIFICATION
I, Nazir Ahmad Tali S/o Ghulam Hassan Tali R/o Azad Gunj,
Baramulla have changed my name to Nazir Ahmad Teli S/o Ghulam
Hassan Teli R/o Gulshan Abad, Azad Gunj, Baramulla. Henceforth, I shall
be known and identified by the name Nazir Ahmad Teli S/o Ghulam
Hassan Teli R/o Gulshan Abad, Azad Gunj, Baramulla. All concerned
persons, authorities, and institutions are requested to take note of the above
change of name and address.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct my name in my Aadhaar Card 2374 5696 1555 which
has been wrongly mentioned as Mehraj Mohd Shaheen instead of Maraj
Mohd Shaheen. Now, I want to correct it as Maraj Mohd Shaheen.
Maraj Mohd Shaheen S/o Gh Nabi
R/o Tral i Payeen, Tral, Pulwama.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4390 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
In Aadhar records bearing Aadhaar No. 6452 8338 4485 my name and
DoB is wrongly written as Abru Fayaz D/o Fayaz Ahmad Malik and DoB
28-07-2006 whileas my original name and DoB is Abiroo Fayaz D/o Fayaz
Ahmad Malik and DoB is 04-05-2009. Now, I want to correct it.
Abiroo Fayaz D/o Fayaz Ahmad Malik
R/o Sonim, Baramulla, Pattan.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sham Kumar F/o Akshara Mahajan R/o Garhi, Tehsil & District
Udhampur (JK UT) inform that my daughter namely Akshara Mahajan
studying in 12th class in K. V. No. 1, Udhampur, Admission No. 34711
but in her school records her father’s name (my name) has been wrongly
entered as Shyam Kumar instead of correct name Sham Kumar. Now, I
am applying for correction as same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4391
NOTIFICATION
I want to correct my name in my Aadhaar Card bearing No. 6111 3600
2332 from Hanan Ahmad to Hinan Ahmad Shah as per my school
documents.
Hinan Ahmad Shah S/o Mushtaq Ahmad Shah
R/o Dangerpora, Sopore.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is for information to the general public that my name and
husband's name has been recorded as Fatima Bano and Ghulam Mohi ud
Din Bhat in my Aadhaar Card bearing Aadhaar No. 7201 6104 3706 but
the actual name and husband's name as per my legal documents is fata and
Gh Mohi Ud Din Bhat. Now, I am applying for correction of my name and
Husband’s name.
Fata W/o Gh Mohi ud Din Bhat
R/o Badipora, Chadura.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4392 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
We Syedul Nisa & Gh Hassan Hajam are holding 1000 shares of J&K
Bank Ltd. under Folio JKB027480 where our names have been
inadvertently recorded as Syed Ul Nisa & Ghulam Hassan Hakim both of
which are incorrect whereas our actual names are Syedul Nisa & Gh
Hassan Hajam. In this regard we are applying for correction of our names
under the said Folio.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shahnaz Rasool want to change my name in my Aadhaar Card
bearing No. 2947 7654 7612 from Shanaz Pari Kounser to Shahnaz
Rasool.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4393
NOTIFICATION
I, Gaurju Khajuria W/o Sham Lal Khajuria R/o H. No. 146, Ward
No.1, Near Sports, Stadium, Subash Nagar, Tehsil & District Udhampur
J&K, Pincode 182101 want to correct name of my self which has been
wrongly written as Kanta Khajuria and DoB as 20-06-1940 in my Passport
bearing No. N6393443. My actual and correct name is Gaurju Khajuria
and correct DoB is 28-04-1940 as per other records i.e. Pan Card, Aadhaar
Card and other documents. Now, I am applying for correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar Card bearing No. 9675 1613 3380 the name of my son is
recorded as Wasif whileas his actual and correct name is Muhammad
Wasif Sheikh. Now, change/correction is required.
Mushtaq Ahmad Sheikh F/o Muhammad Wasif Sheikh
R/o Kanitar, Hazratbal, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4394 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I have changed my name from (Old Name) Hamad Muzamil
Makhdoomi to (New Name) Hammad Muzamil Makhdoomi. In future I
will be known as (New Name) Hammad Muzamil Makhdoomi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Lal Hussain S/o Mohd Missri R/o Gughrota, Tehsil Kotranka,
District Rajouri declare that my daughter's name has been wrongly
recorded in the Aadhaar Card bearing Aadhaar No. 2498 6591 2577 as
Rufina Kosser instead of her correct name Rafina Kosser which is correct
in all respects. Now, I am applying foir its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4395
NOTIFICATION
In Aadhaar Card bearing No. 7074 2238 3581 my name is recorded as
Sonye Akhter while as my actual and correct name is Saniya Hamid. Now,
change/correction is required.
Saniya Hamid D/o Ab Hameed Dar
R/o Near Aada Mohalla, Shallabugh, Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Nissar Hussain F/o Sajjid Hussain R/o Naghoon, Tehsil and District
Rajouri applying for correction of my Son's name which is wrongly
written as Sajad Hussain instead of correct Sajjid Hussain in his Aadhaar
Card bearing No. 3245 2312 3447.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4396 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct my Aadhaar Card name under No. 2645 2649 8678
from Sidra Batool to Sofia Hilal. Now, I am applying for its correction.
Sofia Hilal D/o Hilal Ahmad Rather
R/o Sheerinabad.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Aksar Begum W/o Mohd Shabir R/o Sawani, Tehsil and District
Rajouri applying for correction of my daughter’s name which is wrongly
written as Divya Mahajan instead of correct Afia Kouser in my Aadhaar
Card.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4397
NOTIFICATION
In Aadhaar Card Bearing No. 3411 2291 6414 my name is recorded
as Ayesha while as my actual and correct name is Asha Bano. Now,
change/correction is required and the same is to be corrected in my PAN
bearing No. CFZPA3676N. Now, I am applying for its correction.
Asha Bano W/o Nazir Ahmad Jan
R/o Meebagh, Brein, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Naveed Hashmi applying for correction of father’s name and
mother’s name of my children namely (1) Syed Mohammad Ali S/o
Naveed Hashmi, Mother Saima Aslam, DoB 18-04-2018, (2) Syed
Hasnain Hashmi S/o Naveed Hashmi, Mother Saima Aslam, DoB 16-11-
2019. (3) Syed Abdullah Hashmi S/o Naveed Hashmi, DoB 24-03-2022.
But in birth certificate at serial (1) father name has been wrongly written
as Syed Naveed Hashmi whereas mother name has been written as Syed
Saima Naveed Hashmi. At serial (2) & (3) Father's name has been written
as Syed Naveed Hashmi. I have applied for correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4398 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
It is hereby informed to the general Public that in my school records
the name of my mother is Mehnaz Hilal which is different in my passport
details. The correction I need to make is Mehnaz Majid instead of Mehnaz
Hilal. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
name is wrongly written as Nadia Nisar Bhat instead of Nadia Mehraj.
Now, I want to apply for its correction.
Mrs. Nadia Mehraj W/o Nisar Ahmad Bhat
R/o Shahi Hamdan Colony, Ali Jan Road, Zoonimar, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4399
NOTIFICATION
I, Jado Devi W/o Sh Bag Singh R/o Village Dalsar, P/o Dalsar, Tehsil
Ramnagar, District Udhampur, Jammu and Kashmir, UT, 182122 declare
that my name has been wrongly written as Jido Devi instead of Jado Devi
in my Aadhaar Card bearing registration No 8035 0217 1556. Now, I am
applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Romal Singh F/o Arjanu R/o Village Chhatriari, P/o Majouri, Tehsil
Basantgarh, District Udhampur, Jammu and Kashmir, UT, 182128 declare
that my Son’s name has been wrongly written as Arjun instead of Arjanu
in my Aadhaar Card bearing registration No. 2996 0472 7568. Now, I am
applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4400 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Fehmida Begum am holding 1000 shares of J&K Bank Ltd. under
Folio JKB013622 where my name has been inadvertently recorded as
Fehmida Bhat which is incorrect whereas my actual name is Fehmida
Begum. In this regard I am applying for correction of name under the said
Folio.
Fehmida Begum W/o Ghulam Rasool Bhat
R/o Banigam, Shalimar, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammad Mubbashir Salman Rais am holding 1000 shares of
J&K Bank Ltd. under Folio JKB017584 where my name has been
inadvertently recorded as Mohd Mubbashir Rais which is incorrect
whereas my actual name is Mohammad Mubbashir Salman Rais. In this
regard, I am applying for correction of name under my Folio.
Mohammad Mubbashir Salman Rais
S/o Late Sheikh Mohammad Rais
R/o Tilak Nagar, Nawab Ganj, Kanpur, Uttar Pradesh
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4401
NOTIFICATION
I, Sajad Hamid Sheikh am holding 5586 Shares of J&K Bank Ltd.
under Client ID No. IN30234910321924 where my name has been
inadvertently recorded as Sajad Ahmad Sheikh which is incorrect whereas
my actual name is Sajad Hamid Sheikh. In this regard, I am applying for
correction of name under the said Client ID.
Sajad Hamid Sheikh S/o Abdul Hamid Sheikh
R/o Kanlibagh, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Ali Mohammad Wani am holding 3000 of shares of J&K Bank Ltd.
under Folio JKB036365 jointly with Habla Bano Wani & Shazia Ali where
the names of 1 & 2 holder have been inadvertently recorded as Ali Mohd
Wani & Habla which are incorrect whereas our actual names are Ali
Mohammad Wani & Habla Bano Wani. In this regard we are applying for
correction of names under the said Folio.
Ali Mohammad Wani, Habla Bano Wani & Shazia Ali
R/o Lane-4, Ibrahim Colony, Parray Pora, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4402 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Asha W/o Mohd Shafi Reshi state that I am holding a bank account
with J&K Bank Ltd. Under Account No. 0753040100002182 at Habbak
branch where my name has been recorded as Ayesha Bano W/o Mohd
Shafi Reshi which is incorrect whereas my actual name as per my KYC
Documents is recorded as Asha W/o Mohd Shafi Reshi. In this regard I
am applying for correction of name under the saidd bank account.
Asha W/o Mohd Shafi Reshi
R/o Khimber, Rishi Pora, Chhatrahama.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of general public that my name
mentioned in Aadhaar Card bearing No. 8523 8979 9972 is Kulsuma Bano
D/o Abdul Rashid Mir which is wrong however my actual name is
Subeeka Akhter D/o Abdul Rashid Meer. Now, I intend to rectify my name
in my Aadhaar Card.
Subeeka Αkhter D/o Abdul Rashid Meer
R/o Korag Domarg, Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4403
NOTIFICATION
In my Aadhaar Card bearing No. 5369 1115 1655 my name has been
mentioned as Syed Kounser Javeed and DoB as 11-05-1970. Whileas my
correct name is Kounsar Jan Alvi and DoB 01-01-1960. Now, I want to
apply for the correction of the same in my Aadhaar Card.
Kounsar Jan Alvi W/o Syed Javeed Hussain Byhaqi
R/o Iqbal Colony, Lane No. 3, Wanabal, Shankerpora,
Nowgam, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Prethipaul Singh S/o Harbans Singh R/o Chatoosa, Tehsil
Dangiwacha, District Baramulla, inform the general public that in Aadhaar
details bearing Aadhaar No. 4106 5065 9489 my name is wrongly
recorded as Prithipal Singh S/o Harbanas singh. The correct and legal
name is Prethipaul Singh as per school records and other educational
documents. That Prithipal Singh and Prethipaul Singh refer to the same
person. Now, I am applying for its correction.
Prethipaul Singh S/o Harbans Singh
R/o Chatoosa, Tehsil Dangiwacha, District Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4404 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is to inform general public that my daughter namely Sumiya Jaan
name has been wrongly entered in the Aadhaar Card records bearing
Aadhaar Card No. 7429 5244 8069 as Samai Jan instead of Sumiya Jaan
as per Domicile certificate. Now, I am applying for its correction.
Irshad Ahmad Mughal F/o Sumiya Jaan
R/o Manigah, Tehsil & District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to Correct my Aadhaar Card name bearing No. 8303 8700 4892
from Areeba Ashiq F/n Yasmeena Bano, DoB 28-12-2016 R/o Quanan
Babagund to correct name Hafsa Aashaq D/o Aashaq Hussain Lone, DoB
28-12-2018, R/o Kanthpora, Lolab, District Kupwara. Now, I am applying
for the Correction.
Hafsa Aashaq D/o Aashaq Hussain Lone, DoB 28-12-2018
R/o Kanthpora, Lolab, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4405
NOTIFICATION
I want to correct the name, parentage & DoB of my daughter in her
Aadhaar Card bearing No. 3351 9882 6683 from Afshana Javeed
D/o Javeed Ahmad Wagay, DoB 13-12-2012 to Afsha Javid D/o Javid
Ahmad Wagay, DoB 08-06-2012 as per her Birth certificate.
Javid Ahmad Wagay F/o Afsha Javid
R/o Zakura Hazratbal, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I have changed my name from (old name) Gulshion Bano to (new
name) Gulshan Bano. In future, I will be known as (new name) Gulshan
Bano as per my Aadhaar Card.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4406 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Sakinah Begum W/o Farooq Ahmad Khan R/o Taki Sultan, Tehsil
& District Baramula, J&K do hereby declare that my name, spouse name
and address have been wrongly entered in the Aadhaar records bearing No.
2257 3509 3154 as Sajani Devi W/o Farook R/o Kharsari, Uttarkashi,
Gaddugaad, Uttarakhand while as my correct details as per my domicile
certificate & affidavit are Sakinah Begum W/o Farooq Ahmad Khan
R/o Taki Sultan, Tehsil & District Baramulla, J&K. Now, I am applying
for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Saima Jamal D/o Mohammad Jamal Sheikh R/o Khawja Bagh,
Baramulla, District Baramulla, J&K do hereby declare that my name,
father's name, address & DoB have been wrongly entered in the Aadhaar
records bearing No. 7647 0478 5436 as Rozey C/o Nazir Ahmad Sheikh
R/o Parimpora Ghat, District Srinagar, DoB 01-01-1984 while as my
correct details as per school certificate & affidavit are Saima Jamal C/o
Mohammad Jamal Sheikh R/o Khawaja Bagh, Baramulla, J&K, DoB
10-10-1996. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4407
NOTIFICATION
I want to correct the name & address of my son in his Aadhaar Card
bearing No. 4576 4503 6404 from Aihal Javeed to Aahil Javeed and
address from Kuddhar, Dhandal, Kasti Garh, District Doda, J&K to Baneel
Kuddhar, Dhandal, Doda, J&K as per his birth certificate.
Javeed Ahmed F/o Aahil Javeed
R/o Baneel Kuddhar, Dhandal, Doda, Jammu & Kashmir.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I have change my name from Jawhira Bano to Jowhara Banoo. In
future I will be known as Jowhara Banoo. Now, I am applying for its
correction.
Jowhara Banoo
R/o Bunpora, Reshipora, Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4408 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
It is information for general public that the name of my ward was
wrongly mentioned as Hamzah Farooq instead of Tazvi Farooq on my
online Aadhaar Card bearing No. 3181 2276 1164. Now, I want to correct
the same.
Farooq Ahmad Thoker F/o Tazvi Farooq
R/o Heffkuri, Tehsil Chitragam, District Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is hereby informed to the general public that the name of my
daughter has been incorrectly recorded in her Aadhaar Card bearing No.
4861 6397 9292 as Aashia Hayat. However, as per her Matriculation
Certificate her correct name is Aaishia Hayat. Now, I am applying for the
correction of her name in the Aadhaar records.
Hayat Mohammad Najar F/o Aaishia Hayat
R/o Dawar, Gurez, Bandipora.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4409
NOTIFICATION
It is hereby notified that the name and DoB of my daughter in Aadhaar
No. 6315 9650 5551 have been wrongly recorded as Soliya Jan, DoB
01-01-2009. The correct particulars are Soliha Nazir, DoB 05-08-2011.
Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Santosh Kumari D/o Dina Nath W/o Jai Krishan Bhat R/o H.No.
410, Lane No. 4, Laxmi Vihar, Near Tubewell Tomal Colony, Jammu
180002 (UT of J&K) have applied for the correction of my name which is
wrongly written on Aadhaar Card bearing No. 5815 0782 5080 as Santosh
Bhat instead of Santosh Kumari (correct). Now, I am applying for its
correction.
Santosh Kumari.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4410 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Zaiba W/o Lassa Bhat D/o Noor Mohammad R/o Naik Bagh,
Nowgam, Srinagar declare that I have changed my name from Zeba to
Zaiba that I will be known as Zaiba. The both names Zeba and Zaiba
belong to one and a same person. My passport number is M6848248. Now,
I applying for its correction.
Zaiba W/o Lassa Bhat D/o Noor Mohammad Wani
R/o Naik Bagh, Nowgam, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Gulzar Ahmad Wani (as per service record) Mohd Abdullah Wani
R/o Badroo, Tehsil Frisal, District Kulgam want to change my name from
Gulzar Ahmed Wani to Gulzar Ahmad Wani (as per matriculation DoB
certificate).
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4411
NOTIFICATION
I, Gowhar Amin (as per Service records) S/o Mohd Amin R/o
Umarhair, Buchpora, Srinagar want to change my name from Gowhar
Amin to Gawher Amin (as per matriculation DoB Certificate).
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Ashraf Peer S/o Mohd Yousuf Peer, R/o Muqam Auwoora,
District Kupwara declare that I have obtained PAN Card from concerned
authorities Vide No. ASAPA7927N wherein my name, Parentage and
DoB have been wrongly mentioned as Pirzada Mohammad Ashraf instead
of Mohd Ashraf Peer and father as Pirzada Mohammad Yousuf instead of
Mohd Yousuf Peer and DoB as 01-05-1976 instead of 02-02-1969. Now,
I am applying for its correction.
Mohd Ashraf Peer S/o Mohd Yousuf Peer
R/o Muqam Auwoora, DoB 02-02-1969.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4412 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Mohammad Peerzada Khatayee S/o Shafiq Ahmad Peerzada
Khatayee R/o Muqam Awoora, Kupwara applying for correction of my
name which is wrongly written as Peerzada Ghulam Mohamad S/o
Peerzada Shafiq Ahmad instead of correct name Mohammad Peerzada
Khatayee S/o Shafiq Ahmad Peerzada Khatayee in Aadhaar Card bearing
No. 2443 4111 3196.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to Correct my credentials in my Aadhaar Card bearing No. 3099
0674 3187 from Negena Bano D/o Ghulasm Qadir Wani R/o Lasi Pora
Budgam, Beerwah to Nagina Akhter W/o Shabeer Ahmad Dar R/o Brail.
Now, I am applying for the Correction.
Nagina Akhter W/o Shabeer Ahmad Dar
R/o Brail.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4413
NOTIFICATION
I, Shakeel Ahmad Hajam S/o Mohmad Sultan Hajam R/o Batpora
Hyhama, District/Tehsil Kupwara do hereby declare that I have changed
my name from Shakeel Ahmad Hajam to Shakeel Sultan. Henceforth, I
shall be known and identified by the name Shakeel Sultan for all purposes,
including educational, official, legal, financial, and other records. Any
reference to Shakeel Ahmad Hajam and Shakeel Sultan shall be deemed
to refer to one and the same person. This notice is issued for the
information of the general public and all concerned authorities such as
UIDAI Aadhaar No. 2946 6941 0973.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shamim Akther W/o Talib Hussain R/o Sangla, Tehsil Surankote,
District Poonch applying for correction of my Child’s name which is
wrongly written as Ali Ahmed in Aadhaar Card bearing registration No.
7279 4855 2069 instead of my child name as Ali Mohd.Now, I am
applying for correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4414 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in Aadhaar Card bearing Aadhaar No. 3443 6509 1564. Now,
I want to change my name from Meema Begum (old name) to Shameema
Begum (new name) as per domicle certificate Document.
Shameema Begum W/o Javeed Ahmad Hajam
R/o Gundmancher, Lalpora.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mushtaq Ahmad Teeli S/o Gh Mohd Teeli R/o Banderpora
Bijbehara, District Anantnag do hereby inform the general public that my
name has been wrongly mentioned in my Aadhaar Card as Mushatq
Ahmad Teeli. That the correct and actual name is Mushtaq Ahmad Teeli.
Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4415
NOTIFICATION
I, Ab. Khaliq Gakhad S/o Mohd Miskeen Gakhad R/o Margi Dever
state that my daughter's name has been written in the Aadhaar Card as
Bisma Jan instead of Bisma Azam. As my daughter's name is Bisma
Azam. Now, I want to correction my daughter's name in Aadhaar Card as
Bisma Azam instead of Bisma Jan.
Ab. Khaliq Gakhad S/o Mohd Miskeen Gakhad F/o Bisma Azam
R/o Margi Dever, Lolab.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammad Shafi Sofi want to correct the name of my son in his
Aadhaar Card bearing No. 3894 1687 1608 from Wahid Sofi to Washid
Ahmad Sofi as per his DoB certificate.
Mohammad Shafi Sofi F/o Washid Ahmad Sofi
R/o Qazi Bagh, Ichgam, Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4416 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct my name in my Aadhaar Card bearing Aadhaar No.
2744 5224 0813 from Kaifa to Nabiha Touseef. Now, I am applying for
its correction.
Nabiha Touseef S/o Touseef Sagar
R/o Trikanjan.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is informed to general public that the name of my daughter has been
wrongly mentioned in her Aadhaar Card bearing No. 5399 5965 0721 as
Anoosha Aijaz while as per her Birth Certificate the correct name is
Mehnoor Aijaz. Now, I am applying for its correction.
Aijaz Ahmad Dar F/o Mehnoor Aijaz
R/o Hib, Dangerpora.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4417
NOTIFICATION
I want to correct name & DoB of my daughter in her Aadhaar Card
bearing No. 4661 5803 0216 from Abrah Hamid, DoB 07-12-2017 to Ibra
Hamid, DoB 06-12-2017 as per my Domicile Certificate.
Abdul Hamid Dar F/o Ibra Hamid
R/o Raithan, Khan Sahib, Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information for general public that my & my husband’s name in
my Aadhaar Card was wrongly mentioned as Nazah W/o Suhail Ahmad
Dar instead of Shanaza Akhtar W/o Gowhar Hussian Dar R/o Khajapora,
Tehsil Zainpora, District Shopian. Now, I want to correct the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4418 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
It is information for general public that the name of my ward has been
wrongly mentioned in school records and Aadhaar Card as Batulla Jan.
instead of Maryam Batool. Now, I want to Correct it.
Mohd Afzal Dar F/o Maryam Batool
R/o Sandoo, Tehsil and District Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct my Aadhaar Card name, Mother's name and Address
under Aadhaar No. 2442 5120 1998 from Sirat M/n Tabeena Begum R/o
Trikanjan to Seerat Rafiq D/o Rafiq Ahmad Mir R/o Pahlipora, Boniyar.
Now, I am applying for its correction.
Seerat Rafiq D/o Rafiq Ahmad Mir
R/o Pahlipora, Boniyar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4419
NOTIFICATION
I, Jameela Begum M/o Rifat Jan R/o Wangath, Tehsil Kangan, District
Ganderbal, Jammu & Kashmir hereby declare that the correct name of my
daughter is Rifat Jan as per her Domicile Certificate. Due to an inadvertent
error her name has been incorrectly mentioned as Irfat Jan in her Aadhaar
Card bearing No. 5275 2175 7430. It is hereby notified that Rifat Jan D/o
Abdul Hakeem Pakhtoon and Irfat Jan D/o Abdul Hakeem Pakhtoon refer
to one and the same person. Henceforth, the correct name shall be Rifat
Jan for all official records, documents, and future references.
Jameela Begum M/o Rifat Jan
R/o Wangath, Tehsil Kangan, District Ganderbal, J&K.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that my ward’s name has been
wrongly mentioned in in his Aadhaar Card bearing No. 4281 2144 4463.
Now, I want to correct my ward’s name from Mohammad Musa Bin
Javeed Bhat (Old Name) to Ahmad Ibn Javeed Bhat (New Name).
Ahmad Ibn Javeed Bhat S/o Javeed Ahmad Bhat
R/o Rose Enclave, Near Cambridge School, Wanabal, Rawalpora.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4420 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is an information for general public that in my Aadhaar Card
bearing Registration No. 5029 1071 3780, my name and parentage has
been mistakenly mentioned as Mohd Sadaq S/o Doyood Gojar while as
my actual and correct name and parentage as per my Domicile Certificate
is Mohd Sidiq Gojer Baniya S/o Dawood Gojer Baniya. Now, I want to
apply for its correction.
Mohd Sidiq Gojer Baniya S/o Dawood Gojer Baniya
R/o Quilmuqam, Tehsil Aloosa, District Bandipora,
Jammu and Kashmir, India, Pin Code 193502.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar records bearing Aadhaar No. 4886 8013 9513 my name
has been recorded as Kalsoom Banoo D/o Layqat Ali instead of Kalsoom
Akhter D/o Liyakat Ali. It needs correction.
Kalsoom Akhter D/o Liyakat Ali
R/o Waltengo Kund, Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4421
NOTIFICATION
In Aadhaar record bearing Aadhaar No. 2066 5090 1168 my ward’s
name has been recorded as Basit Khursheed Allie instead of Basit Ahmad
Allie. It needs correction.
Khursheed Ahmad Allie F/o Basit Ahmad Allie
R/o Malwan, Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar record bearing Aadhaar No. 3194 7458 6969 my ward’s
name has been recorded as Bhat Zuhaib instead of Zuhaib Manzoor. It
needs correction.
Manzoor Ahmad Bhat F/o Zuhaib Manzoor
R/o Mohammadpora, Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4422 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
In the Aadhaar Card bearing No. 6207 0313 0314 my name &
parentage has been mentioned as Gh. Mohammad Reshi S/o Noordin
Reshi and in the PAN Card bearing No. AMSPR3457J has been mentioned
as Ghulam Mohmad Reshi S/o Nooruddin Reshi. Whileas my correct
name is Ghulam Mohmad Reshie S/o Noor Ud Din Reshie. Now, I want
to apply for the correction of the same in my Aadhaar Card and PAN Card.
Ghulam Mohmad Reshie S/o Noor Ud Din Reshie
R/o Manganwaji Bagati, Kanipora.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammad Rayees S/o Nazir Ahmed R/o Dhanisaidan, Tehsil Uri,
District Baramulla do hereby declare that my name and parentage spelling
has been wrongly recorded in my Aadhaar Card bearing No. 7108 1488
1005 as Rayees Ahmad Mir S/o Nazir Ahmad Mir whileas my
actual/correct name and parentage spelling as per school record is
Mohammad Rayees S/o Nazir Ahmed. Now, the same is to be corrected.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4423
NOTIFICATION
I want to correct my name in my Aadhaar Card bearing Aadhaar No.
5102 3528 4818 from Uzma Begum to Uzma Banoo. Now, I am applying
for its correction.
Uzma BanooW/o Manzoor Ahmad Khan
R/o Warikhah, Pringal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is an information for general public that the Aadhaar Card of my
daughter bearing Registration No. 7239 7377 3007 in online Aadhaar Card
record her name has been mistakenly mentioned as Alina Ali while as her
actual and correct name as per Domicile Certificate and School Record is
Aleena Ali. Now, I want to apply for its correction.
Ali Mohammad Gojar Turk F/o Aleena Ali
R/o Quilmuqam, Tehsil Aloosa, District Bandipora,
Jammu and Kashmir, India, Pin Code193502.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4424 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
It is notified for the information of the general public that my Ward's
name in Aadhaar Card has been wrongly entered as Kafayat Ashraf while
my ward's correct name is Kifayat Ahmad Khanday. Now, I want the same
to be corrected.
Mohd Ashraf Khanday F/o Kifayat Ahmad Khanday
R/o Irote Damjan, Qazigund, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is an information for general public that Aadhaar Card of my
daughter bearing Registration No. 2753 2950 6406 her name has been
mistakenly mentioned as Musbah Mushtaq while as her actual and correct
name as per her Domicile Certificate is Misba Mushtaq. Now, I want to
apply for its correction.
Mushtaq Ahmad Mir F/o Misba Mushtaq
R/o Malangam, Tehsil Aloosa, District Bandipora,
Jammu and Kashmir, India, Pin code 193502.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4425
NOTIFICATION
I, Rafiqa Bano W/o Shabir Ahmad Ganaie R/o Goosu, Pulwama,
hereby inform the general public that my name has been incorrectly
recorded as Rubeena Akhter instead of my correct name Rafiqa Bano in
my Aadhaar Card bearing No. 7258 4505 5762. Now, I have applied for
the correction of my name in the Aadhaar records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information for general public that the name of my ward was
wrongly mentioned as Hurara Farooq instead of Aayina Farooq on her
online Aadhaar Card bearing No. 6348 3114 2456. Now, I want to correct
the same.
Farooq Ahmad Thoker F/o Aayina Farooq
R/o Heffkuri, Tehsil Chitragam, District Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4426 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
My name has been wrongly mentioned in my Aadhaar Card bearing
Aadhaar No. 4519 6311 6503 as Kausara Jan instead of Kousar Jan as per
school records. Now I am applying for correction of the same.
Kousar Jan D/o Ghulam Mohmad Hajam
R/o Gund Dalwash.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my Son issued vide Aadhaar No. 7608 8330
2702 his name has been enrolled as Anas Bin Yousuf instead of
Mohammad Anas Mir. Now, I want to apply for its Correction.
Mohammad Yosuf Mir
R/o Arif Bagh, Hardu Chanam, Rafiabad, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4427
NOTIFICATION
This is to inform the general public that my childs name has been
wrongly mentioned in his Aadhaar Card bearing Aadhaar No. 8922 3049
0242. Now, I want to change his name from Fizahat Jan (old name) to Fiza
Zakir (new name) as per DoB certificate.
Zakir Hussain Dar F/o Fiza Zakir
R/o Wavoora, Lolab.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that my child’s name has been
wrongly mentioned in his Aadhaar Card bearing Aadhaar No. 6969 4407
2505. Now, I want to change his name from Jiver Qayoom (old name) to
Jawhara Qayoom (new name) as per DoB certificate.
Abdul Qayoom Ganaie F/o Jawhara Qayoom
R/o Sogam, Lolab.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4428 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
My particulars have been wrongly mentioned in my Aadhaar Card No.
8372 4632 1207 as Hafeeza Bano D/o Abdul Razaq Hafiz R/o Malapora,
Ganderbal whileas my correct particulars as per School certificate is
Hafiza Bano D/o Abdul Razaq Hafiz R/o Malapora, Ganderbal. Now, I
want its correction.
Hafiza Bano D/o Abdul Razaq Hafiz
R/o Malapora, Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Ms. Masrat Mohiuddin D/o Ghulam Mohi Ud Din Khan R/o
Braman, Rafiabad, District Baramulla, Jammu & Kashmir hereby inform
the general public that my name has been incorrectly recorded in my
Aadhaar Card bearing Aadhaar No. 5881 2150 8551 as Masrat Bano
instead of my correct name Masrat Mohiud din. Now, I am applying for
the correction of my name in the Aadhaar records to reflect my correct
name as Masrat Mohiud din.
Masrat Mohiud din D/o Ghulam Mohi ud din Khan
R/o Braman, Rafiabad, District Baramulla, Jammu & Kashmir.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4429
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar as Nazima Akther While as my actual name is
Shayista Begum C/o Tariq Ahmad Malik R/o Punzwa, Kupwara, District
Kupwara, 193222. Now, I want to apply for the correction of the same.
Shayista Begum C/o Tariq Ahmad Malik
R/o Punzwa, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
My particulars have been wrongly mentioned in my Aadhaar Card
bearing No. 3938 1435 0020 as Jan Mohd Goru S/o Ab Rashid Goru R/o
Sarich Chodri Bagh, Ganderbal whileas my correct name as per Domicile
Certificate is John Mohd Guroo S/o Abdul Rashid Guroo R/o Sarich
Chodri Bagh, Ganderbal. Now, I want to apply for its correction.
John Mohd Guroo S/o Abdul Rashid Guroo
R/o Sarich Chodri Bagh, Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4430 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I, Ab. Rashid Sheikh S/o Mohd Abdullah R/o Village Shangas, Tehsil
Shangas, District, Anantang, J&K (UT) have applied for Correction of my
DoB in Aadhaar Card bearing No. 9036 6505 6653 which has been
wrongly written as 02-03-1977 instead of 02-04-1977. Now, I am applying
for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sakuntala Devi W/o Late Sh Faqir Singh R/o Kot Maira, Tehsil
Khour and District Jammu want to apply for correction of my name and
DoB in my Aadhaar Card that has been wrongly mentioned as Skuntila
Devi and DoB as 10-01-1956 instead of Sakuntala Devi and correct DoB
as 10-04-1956. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4431
NOTIFICATION
I, Mohammad Ajaz S/o Mohammad Din R/o Kirni, Tehsil Haveli,
District Poonch do hereby declare that my actual name is Mohammad Ajaz
which is mentioned on my 10th Marksheet but wrongly written on my
Aadhaar Card as Mohd Ajaz. Now, I am applying for the name correction
on my Aadhaar card as Mohammad Ajaz.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Tahir Rashid War R/o Kultoora, Langate hereby inform the general
public that I intend to update the name of my son in his Aadhaar Card
which is presently recorded as Ansar Tahir, whereas his actual name as
per official records is Mohammad Ansar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4432 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
This is an information for general public that in Aadhaar Card of my
Son bearing Registration No. 6216 2846 9231 his name has been
mistakenly mentioned as Khan Arhan while as his Actual and correct name
as per his Birth certificate issued by Block Development Office Arin is
Muhammad Zarar Khan. Now, I want to apply for its correction.
Abdur Rehman Khan F/o Muhammad Zarar Khan.
R/o Gundpora, Rampora, Bandipora, District Bandipora,
Jammu and Kashmir, India, Pin Code193502.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
ward’s name is wrongly written as Anam Hilal instead of Fatima Hilal.
Now, I want to apply for its correction.
Hilal Ahmad Shah F/o Fatima Hilal
R/o Agri Kalan, Pattan, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4433
NOTIFICATION
This is to bring to the notice of all concerned that the name appearing
on Aadhaar Card No. 3191 0499 4198 is incorrectly recorded as Syed
Maidhat Geelani however Correct name is Syed Midhat Geelani. Now, I
am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
Due to mistake in birth certificate of my son his name has been entered
as Ajwar Ahmad Tantray instead of Tajwar Manzoor Tantray. Now, I have
applied for its correction.
Manzoor Ahmad Tantray F/o Tajwar Ahmad Tantray.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4434 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No.18
NOTIFICATION
I want to correct my details in Aadhaar Card bearing No. 6519 3417
9722 as Subreena W/o Jahangir Ahmad Khan, DoB 01-01-1982 R/o Dohbi
Mohalla, Hazratbal, Srinagar to Sabreena Rashid W/o Jahangir Khan, DoB
21-09-1981 R/o Darzi Mohalla, Hazratbal, Srinagar. Now, I am applying
for correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sonia Devi D/o Mela Ram R/o Village Harsha Dhokrian Halqa,
Tehsil & District Jammu declare that my name has been wrongly written
in my Aadhaar Card bearing No. 9706 5591 5874 as Soni Devi instead of
correct name is Sonia Devi. Now, I am Applying for Correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4435
NOTIFICATION
I have changed my old name from Faraque Ahamd Rather S/o Gh
Ahmad Rather to new name Farooque Ahamd Rather S/o Gh Ahmad
Rather. In future I will be known by my new name Farooque Ahand
Rather S/o Gh Ahmad Rather.
Farooque Ahamd Rather S/o Gh Ahmad Rather
R/o Goshbugh Tehsil Pattan.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mumtaz Akhter W/o Mohd Raj Ali R/o Champari Tehs Chenant
applying for correction of my daughter's name which is wrongly written
as Nahria Akhtar instead of correct Nahira Akhtar in Aadhaar Card.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4436 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Bibi Begum W/o Late Mohd Abdullah R/o Village Koti Tehsil Bani
District Kathua have applied for correction of my name which has been
wrongly written as Rifat Bibi instead of correct name is Bibi Begum in
my Aadhaar Card bearing No 3629 4996 0955.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Ichpal Singh S/o Kiret Singh R /o Sigma H. No. Dashmesh Nagar
Digiana Jammu have applied for correction of my name which has been
wrongly written as Pramjeet Singh instead of correct name is Ichpal Singh
n my Aadhaar Card bearing No. 7362 0991 6042.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4437
NOTIFICATION
In the Aadhaar Card vide Aadhaar No. 5158 6271 6493, my name
has been enrolled as Towqeer Hayat instead of Towqueer Hayat. Now, I
want to apply for it's Correction.
Towqueer Hayat S/o Abdul Hai Dar
R/o Bona Pora, Batamaloo Sgr J&K-190010.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhar Card vide Aadhaar No. 7634 9230 7256, my name has
been enrolled as Mehreen Aijaz instead of Mehreena Aajaz. Now, I want
o apply for it's Correction.
Mehreena Aajaz S/o Ajaz Ahmad Banday,
R/o Rangwara Warnow, Kupwara Sgr J&K-193223.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4438 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mukhtar Ahmad Naikoo F/o Dayim Mukhtar R/o Saidpora Bala
Tehsil and District, Shopian JK declare that the name and DoB of my
ward has been wrongly written in Aadhaar Card as Abu Arkam Naikoo
and 03/01/2012 while as the actual name and DoB is Dayim Mukhtar and
03/01/2016. Now, the same is to be corrected.
Mukhtar Ahmad Naikoo F/o Dayim Mukhtar
R/o Saidpora Bala Tehsil and district Shopian JK UT.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Tabish Akther D/o Mohammad Yousf Malik R/o Qalamabad Tehsi
Langate & District, Kupwara J&K, declare that my name is mistakenly
entered in Aadhaar records vide Aadhaar No.6788 2130 4073 as Tabash
Akhter instead of Tabish Akther. Now, I am applying for its correction.
Tabish Akther D/o Mohammad Yousf Malik
R/o Qalamabad Tehsil, Langate & District-Kupwara.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4439
NOTIFICATION
I, Mohammad Hamid Mir S/o Mohd Rafiq Mir R/o Syed Pora
Harwan Srinagar Tehsil, Khanyar & District Srinagar J&K, declare that
my ward’s name have been mistakenly entered in Aadhaar records vide
Aadhaar No.4060 5289 5581 as Uzhair Rafiq instead of Mohammad
Hamid Mir. That My Correct and Actual name is Mohammad Hamid Mir
and the same may be entered in Aadhar Records. Now, the same is to be
orrected.
Mohammad Hamid Mir S/o Mohd Rafiq Mir
R/o Syed pora Harwan Srinagar Tehsil, Khanyar & District-Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card vide Aadhaar No. 9847 4627 7116, my name has
been enrolled as Ashia Bano instead of Aisha Bano. Now, I want to apply
for it's Correction
Aisha Bano D/o Mohd Maqbool Magray
R/o War Mohalla Thune, Kangan J&K-191202.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4440 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In the Aadhar Card of my ward issued vide Aadhaar No. 6389 9233
5810, her name has been enrolled as Ayesha Javaid instead of Mir Aisha.
Now, I want to apply for it's Correction.
Mir Aisha C/o Javaid Ahmad Mir
R/o Gasoo Hazratbal, Srinagar, Jammu and Kashmir-190006.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my ward issued vide Aadhaar No. 9359 9798
3917, her name has been enrolled as Rutba Javaid instead of Rutiba
avaid. Now, I want to apply for it's Correction.
Javaid Ahmad Mir F/o Rutiba Javaid
R/o Gasoo, Mir Mohalla Hazratbal Jammu and Kashmir-190006.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4441
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
ward’s namehas been wrongly written as Mohd Amir Sheikh S/o Manzoor
Ahmad Sheikh instead of Mohd Aamir Mochi S/o Manzoor Ahmad
Mochi. Now, I want to apply for its correction.
Manzoor Ahmad Mochi F/o Mohd Amir Mochi
R/o Sheikhpora Anantnag.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Azar Balkeez D/o Shahib Hussain R/o Village Dara Dullian,
Tehsil Haveli, District Poonch applying for the correction of my name
which is wrongly written as Azhar Balkeez instead of Azar Balkeez in
Aadhaar Card bearing No. 7077 7324 0932 and other documents.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4442 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
Mukhti Begam W/o Wali Mohd Ro Village Gagrian, Tehsil Mandi,
District Poonch applying for the correction of my name which is wrongly
written as Mukhati Begum instead of Mukhti Begam in Aadhaar Card
bearing No. 2273 2325 4429 and other documents.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Liyaqat Ali S/o Ilam Din R/oVillage Saral, Tehsil Haveli, District
Poonch, applying for the correction of my name which is wrongly written
as Layaqat Ali instead of Liyaqat Ali in my Aadhaar Card bearing No.
7093 5294 5254 and other documents.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4443
NOTIFICATION
I, Lal Din S/o Raj Mohd R/o Village Shahpur, Tehsil Haveli,
District Poonch applying for the correction of my Son's name which is
wrongly written as Sadiqat Iqbal instead of Sadaqat Iqbal in Aadhaar Card
bearing No. 8827 9214 5990. Now the same is to be corrected.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Majaid Iqbal S/o Jamal Din R/o Village Shahpur, Tehsil Haveli,
District Poonch applying for the correction of my Brother's name which is
wrongly written as Naziqat Iqbal instead of Nazakat Iqbal in Aadhaar
Card bearing No. 2864 5396 1262.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4444 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Rita Devi W/o Sh Romesh Kumar R/o H.No. 38 Ward No. 5
exchange road Reasi District Reasi Jammu Kashmir UT 182311 declare
hat my name has been wrongly written as Veena Devi instead of Rita
Devi in my Aadhaar Card bearing registration No. 6901 1028 6242. Now,
am applying for the correction of same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Santosh Devi W/o Sh Sanjay Kumar R/o Village Jandrari PO
andari Teheil Ramnagar District Udhampur Jammu and Kashmir UT
82122 declare that my name has been wrongly written as Santosh
Kumari instead of Santosh Devi in my Aadhaar Card bearing registration
No. 8791 2055 7800. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4445
NOTIFICATION
I, Sunita Devi W/o Sh Raj Kumar M/o Anjali Devi R/o Village
Kirmoo PO Deheri Teheil Ramnagar District Udhampur Jammu and
Kashmir UT 182122 declare that my daughter’s name has been wrongly
written as Anjali Sharma instead of Anjali Devi in my daughter Aadhaar
Card bearing registration No. 6348 0831 2779. Now, I am applying for
he correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Zakir Hussain Shah S/o Haider Hussain Shah R/o Village Farole
Post Office Blandh Tehsil Ramnagar District, Udhampur Jammu and
Kashmir UT-182122 declare that my name has been wrongly written as
Zakir Hussain instead of Zakir Hussain Shah in my Aadhaar Card bearing
egistration No. 5193 9262 1734. Now, I am applying for the correction of
he same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4446 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Rajinder Singh F/o Shreya Thakur R/o Village Charat PO Charat
Tehsil ,Chanani District, Udhampur Jammu and Kashmir UT 182141
declare that my Daughter’s name has been wrongly written as Riya
Thakur instead of Shreya Thakur in my daughter’s Aadhaar Card bearing
egistration No. 5035 8517 0772. Now, I am applying for the correction of
he same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Jagdish Kumar F/o Akanksha Sharma R/o Village Narora
Kainthgali District, Jammu and Kashmir UT Udhampur 182125 declare
hat my daughter’s name has been wrongly written as Aankasha Sharma
nstead of Akanksha Sharma in her Aadhaar Card bearing registration No.
2889 4663 4785. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4447
NOTIFICATION
I, Mohan Kour W/o Amar Singh R/o Village Simbal Morh Basti
Govindpura Dhande Kalan Tehsil R.S Pura District Jammu, states that my
name has been wrongly recorded as Mohan Kaur instead of correct name
Mohan Kour in my Aadhaar Card No. 8104 6006 5338 issued by the
oncerning authorities. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
My actual name is Ghulam Hussain Dar S/o Abli Dar R/o Magam,
Distrcit Budgam, but it has been wrongly written as Gulam Hussain Dar
on Passport bearing No. L8667948. Now, I intend to correct the same in
my Passport.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4448 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is informed to the general public that my name has been wrongly
mentioned in Aadhaar Card as Abdul Majeed Kumar while my correct
name as per my documents is Abdul Majid Kumar. Now, I want to update
my name as Abdul Majid Kumar instead of Abdul Majeed Kumar In my
Aadhar card.
Abdul Majid Kumar S/o Mohd Shaban Kumar
R/o karewa Rampora mattan anantnag Jammu and Kashmir- 192125.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Bank records bearing Account No. 0048010100027603 my
name has been mentioned as Iqbal Mir while as my correct name is Mohd
qbal Mir which is mentioned in my Aadhaar Card bearing No. 7631 0663
7244 also. Now, I want to apply for the correction of the same in the Bank
ecords.
Mohd Iqbal Mir S/o Gh Hassan Mir R/o Zurhama Kupwara.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4449
NOTIFICATION
I have changed my name from Ab. Hamid (old name) to Peerzada
Abdul Hamid (new name). In future, I will be known as Peerzada Abdul
Hamid (new name).
Peerzada Abdul Hamid S/o Ghulam Mohi ud Din Peerzada
R/o Poshwani Pattan, District, Baramulla Kashmir.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct my name in my Agriculture & Farmers Welfare
Deptt. Service Book ID No. ALMAGR00190002, from Mohamad
Yaqoob S/o Ghulam Hassan Dar to Mohammad Yaqoob Dar S/o Ghulam
Hassan Dar as per my matriculation certificate/ appointment order. Now
he same is to be corrected.
Mohammad Yaqoob Dar S/o Ghulam Hassan Dar
R/o Hyderpora, Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4450 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In Aadhaar Card bearing No. 5728 5909 1928 my name is recorded
as Kousar Lateef while as my actual and correct is Kounsar Nisa. Now
hange/correction is required.
Kounsar Nisa D/o Mohd Lateef Bhat
R/o Maloora Parimpora Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar Card bearing No. 5965 7300 7253 my name is recorded
as Shagufta Nabi while as my actual and correct name is Suraiya Nabi.
Now change/correction is required.
Suraiya Nabi D/o Gh Nabi Kaloo
R/o Boat Main Colony Bemina Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4451
NOTIFICATION
In Aadhaar Card bearing No. 6893 6370 7345 my name is recorded
as Bashir Ahmade Gazi while as my actual and correct name is Basharat
Bilal. Now change/correction is required.
Basharat Bilal S/o Bilal Ahmad Gazi
R/o Firdous Abad, Fruit Mandi Parimpora Ghat, Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar Card bearing No. 2308 3532 3527 the name of my son is
ecorded as Ahmed Trumboo instead of his correct name Mohammad
Ahmed Trumboo. Now change/correction is required.
Omar Trumboo F/o Mohammad Ahmed Trumboo
R/o Trumboo House Gupt Ganga, Ishber Nishat Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4452 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In Aadhaar Card bearing No. 4331 7210 4641 my name is recorded as
Mumin Tariq while as my actual and correct name is Moomin Tariq. Now
hange/correction is required.
Moomin Tariq S/o Tariq Ahmad Bhat
R/o Budshah Nagar Natipora, Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar Card bearing No. 6027 8577 3768 my name is recorded as
mran Rashid Bakshi while as my actual and correct name is Bakshi
mran. Now change/correction is required.
Bakshi Imran S/o Abdul Rashid Bakshi
R/o Bilal colony Bemina, Srinagar.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4453
NOTIFICATION
I, Messu Ram S/o Sh Sadhu Ram R/o Village Draman Tehsil Basohli
District, Kathua Jammu and Kashmir UT 184201 declare that my name
has been wrongly written as Mashu Ram instead of Messu Ram in my
Aadhaar Card bearing registration No. 9253 0454 9568. Now, I am
applying for the correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Jagdish Chander F/o Dheeraj Atri R/o Village Deheri PO Deheri
Teheil Ramnagar District, Udhampur Jammu and Kashmir UT-182122
declare that my ward’s name has been wrongly written as Dhreej Atri in-
tead of Dheeraj Atri in my son aadhar card bearing registration no 8986
0731 1233. Now i am applying for the correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4454 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Parshotam Singh F/o Yuvaraj Singh R/o Village Sangar Ransio
District, Reasi Jammu and Kashmir UT-185203 declare that my ward’s
name has been wrongly written in his Aadhaar Card bearing registration
No. 5694 6100 7146 as Yugraj Singh instead Yuvraj Singh. Now, I am
applying for the correction of same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Surju Devi W/o Sh Amar Chand R/o Village katera Bindla PO
Barmeen District, Udhampur Jammu and Kashmir UT-182124 declare
hat my name has been wrongly written as Surjo Devi instead of Surju
Devi in my Aadhaar Card bearing registration No. 2279 94880159. Now,
am applying for the correction of the same.
It is certified that I have complied with other legal requirements in
this connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of
UT of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4455
NOTIFICATION
I, Nab Faker S/D/W/o Gaffar Faker R/o Gonipora, Tehsil Kunzer,
District Baramulla, hereby notify that my name has been wrongly recorded
in my Aadhaar Card bearing No. 3280 4863 1154 as Ghulam Nabi Shah.
My correct and actual name is Nab Faker. Henceforth, I shall be known
and recognized by the name Nab Faker for all legal and official purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I intend to correction my name in my Aadhaar Card UID No. 3056
4751 4676 from Adeeb Hussain Khan to Ahmad Hussain Khan. In future,
I will be known as Ahmad Hussain Khan.
Ahmad Hussain Khan S/o Reyaz Ahmad Khan
R/o Nutnussa.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4456 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Chialoo Begum W/o Sayine R/o Village Kencha, Tehsil Kahara,
District Doda, Jammu and Kashmir UT-182203. That my name has been
wrongly written as Chaloo Begum instead of Chialoo Begum in my
Aadhaar Card bearing No. 4841 6887 4368. Now, I am applying for the
correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Prem Lal S/o Sh Shanker Lal R/o Village Bhatoli, Tehsil Kahara,
District Doda, Jammu and Kashmir UT that my name has been wrongly
written as Prame Lal instead of Prem Lal in my Aadhaar card bearing No.
9694 9235 3623. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4457
NOTIFICATION
I, Rukam Din F/o Savina Kausar R/o Village Mahi Chak, PO Barnote,
District Kathua, Jammu and Kashmir, UT-184143. That my daughter
name has been wrongly written as Shivna Kausar instead of Savina Kausar
in my daughter Aadhaar Card bearing No. 3144 8527 2820. Now, I am
applying for the correction of same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Kartar Chand F/o Sakashi Devi R/o Village Incha, PO Amroh,
Teheil Ramnagar, District Udhampur, Jammu and Kashmir, UT-182122.
That my daughter’s name has been wrongly written as Sankashi Devi
instead of Sakashi Devi in my daughter’s Aadhaar Card bearing No. 6406
4328 0264. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4458 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Wahid S/o Haji Gujar R/o Village Jad, PO Sumb, Tehsil and District
Samba, Jammu and Kashmir, UT-184121. That my name has been
wrongly written as Mohd Wahid instead of Wahid in my Aadhaar Card
bearing No. 5423 5498 6302. Now, I am applying for the correction of the
same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Veerta Devi D/o Sh Hans Raj R/o Village Lehair, PO Joffer, Tehsil
Ramnagar, District Udhampur, Jammu and Kashmir, UT-182128. That my
name has been wrongly written as Nirta Devi Instead of Veerta Devi in
my Aadhaar Card bearing No. 7654 6327 3608. Now, I am applying for
the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4459
NOTIFICATION
I, Mohammed Fareed S/o Daud R/o Village Kella, PO Sattian, Tehsil
Ramnagar, District Udhampur, Jammu and Kashmir, UT-182122. That my
name has been wrongly written as Farid Ali instead of Mohammed Fareed
in my Aadhaar Card bearing No. 7864 2720 9452. Now, I am applying for
the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Tafaij S/o Naik Alam R/o Mehari Gujjran, Tehsil and District
Rajouri applying for correction of my name which is wrongly written as
Mohd Tafaj instead of correct Mohd Tafaij in my Aadhaar Card bearing
No. 9622 8117 6304. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4460 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohd Amin F/o Heana Kosser R/o Ujhan, Tehsil Darhal, District
Rajouri applying for correction of my daughter’s name which is wrongly
written as Heena Kosser instead of correct Heana Kosser in my Aadhaar
Card bearing No. 8625 5413 6717. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Kabeen Kousar W/o Sayaf Ahmed R/o Naka Manjhari, Tehsil
Mendhar, District poonch want to apply for correction of my son’s name
and declare that my son name is incorrectly mentioned as Rekhan Sayaf
instead of Rehan Sayaf in his Aadhaar Card bearing No. 7946 6509 5887.
Hence, Rehan Sayaf is his correct name and used for all future references
and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4461
NOTIFICATION
I, Nahid Akhter W/o Abdul Majeed R/o Naka Manjhari, Tehsil
Mendhar, District poonch want to apply for correction of my son’s name
and declare that my son’s name is incorrectly mentioned as Sajid Majid
instead of Sajid Majeed in his Aadhaar Card bearing No. 7288 7676 2326.
Hence, Sajid Majeed is his correct name and used for all future references
and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sharoon Akhter W/o Mohd Shabir R/o Ari, Tehsil Mendhar, District
Poonch want to apply for correction of my daughter’s name and declare
that my daughter’s name is incorrectly mentioned as Naida Akhter instead
of Nahida Kouser in her Aadhaar Card bearing No. 5448 5093 5926.
Hence, Nahida Kouser is correct name of my daughter and used for all
future references and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4462 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Zafar Iqbal S/o Abdul Majeed R/o Balnoi, Sagra, Tehsil Mankote
District Poonch want to apply for correction of my name and declare that
my name is incorrectly mentioned as Zaffer Iqbal instead of Zafar Iqbal in
my Aadhaar Card bearing No. 5298 8308 4223. Hence, Zafar Iqbal is my
correct name and used for all future references and records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mukhtar Hussain S/o Maqbool Hussain R/o Sagrawat, Tehsil
Darhal, District Rajouri applying for correction of my daughter’s name
which is wrongly written as Imsaa Anjum instead of correct Amsa Anjum
in my Aadhaar Card bearing No. 8854 2307 1896. Now, I am applying for
the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4463
NOTIFICATION
I, Altaf Hussain S/o Mohd Azam R/o Tehsil Darhal, District Rajouri
that I have applied for correction of my in my son’s name which is wrongly
written as Mehtab Ahmed in Aadhaar Card bearing No. 3418 1573 3716
instead the correct name written in all other documents Mohd Mehtab.
Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shamim Akhter W/o Fazal Hussain R/o Village Jamola, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my name is wrongly recorded as Sakeena Akhter in my
Aadhaar Card UID No. 3548 2234 0873. The correct name is Shamim
Akhter. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4464 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Baby Tabasum W/o Manzoor Ahmad R/o New Colony Batmaloo,
Srinagar declare that my name appears as Tabasum in my Aadhaar Card
bearing No. 7405 2644 5923 and Baby Tabasum in my pension records.
Both names refer to one and the same person. Hence forth, Baby Tabasum
shall be treated as my correct name for all official purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Nazik Hussain Shah S/o Mubrak Shah R/o Village Draj, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my name is wrongly recorded as Nazik Hussan Shah in my
Aadhaar Card UID No. 8040 1148 9382. The correct name is Nazik
Hussain Shah. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4465
NOTIFICATION
I, Mohd Ashrif S/o Mohd Bashir R/o Village Udhan (Owdan), Tehsil
Khawas, Sub District Budhal, District Rajouri, J&K-185201, hereby
declare that my name is wrongly recorded as Mohd Ashraf in my Aadhaar
Card UID No. 8509 8659 1665. The correct name is Mohd Ashrif. Now,
it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shameem Akhter W/o Mohd Farooq R/o Village Jamola, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, applying
for correction of my son's name and DoB which are wrongly written as
Mohd Arshad & DoB 26-01-2013 instead of correct Mohd Arshid & DoB
20-05-2018 in Aadhaar Card bearing No. 2147 4387 6520 and my
daughter's name & DoB was wrongly written as Arshad Begum & DoB
01-01-2016 instead of correct Irshad Begum & DoB 05-10-2019 in
Aadhaar card bearing No. 5526 2850 3047. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4466 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohd Shafi S/o Makhna R/o Village Mohra, Tehsil Kotranka, Sub
District Budhal, District Rajouri, J&K, hereby declare that my son's name
and DoB are wrongly recorded as Mohd Asaf and 01-01-2006 in his
Aadhaar Card UID No. 4818 0743 3709. The correct name and DoB are
Mohd Asif and 15-12-2010. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Ayoub S/o Mandhia R/o Village Swari, Tehsil Kotranka, Sub
District Budhal, District Rajouri, J&K-185132, hereby declare that my
daughter's name and DoB are wrongly recorded as Summaria Ayoub and
28-12-2017 in her Aadhaar Card UID No. 6640 9710 4846. The correct
name and DoB are Samaira Ayoub and 10-12-2016. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4467
NOTIFICATION
I, Layaqat Ali S/o Manir Hussain R/o Village Kanthol, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K, hereby declare that
my daughter's name and DoB are wrongly recorded as Rakia Kouser and
01/02/2018 in her Aadhaar Card UID No. 9160 5572 4509. The correct
name and DoB are Anaya Chowdhary and 02/02/2018. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Arash S/o Mohd Ashraf R/o Village Samote, Tehsil Kotranka,
Sub District Budhal, District Rajouri, J&K-185233, hereby declare that
my son's name is wrongly recorded as Araz Razaq in his Aadhaar Card
UID No. 7205 7755 1329. The correct name is Mohd Ariz Razaq. Now, it
needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4468 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohd Farooq S/o Nazir Hussain R/o Village Kotranka, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my daughter's name is wrongly recorded as Sanena Bhat in
her Aadhaar Card UID No. 7396 7658 4563. The correct name is Sunaina
Bhat. Now, I want to apply for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Alaf Din S/o Bhullu R/o Village Targain, Tehsil Kotranka, Sub
District Budhal, District Rajouri, J&K-185233, hereby declare that my
son's name is wrongly recorded as Sobbat Ali in his Aadhaar Card UID
No. 4343 2895 7515. The correct name is Sobit Ali. Now, I am applying
for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4469
NOTIFICATION
I, Zabaida Begum W/o Mohd Jamil R/o Village Kandi, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my name is wrongly recorded as Zubida Begum in my
Aadhaar Card UID No. 6728 7231 7518. The correct name is Zabaida
Begum. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Nagina Begum W/o Anwar Hussain R/o Village Kanthol, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185202, hereby
declare that my name is wrongly recorded as Nageena Begum in my
Aadhaar Card UID No. 9459 3255 5035. The correct name is Nagina
Begum. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4470 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Jamil Ahmed S/o Bashir Ahmed R/o Village Samote, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my daughter's name is wrongly recorded as Robina Ακhter in
her Aadhaar Card UID No. 9454 2332 9105. The correct name is Rabina
Akhter. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammed Bashir S/o Munshi R/o Village Larkoti, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my name is wrongly recorded as Mohd Bashir in my Aadhaar
Card UID No. 5389 8928 6919. The correct name is Mohammed Bashir.
Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4471
NOTIFICATION
I, Mohd Javaid S/o Mohd Rashid R/o Village Kandi, Tehsil Kotranka,
Sub District Budhal, District Rajouri, J&K-185132, hereby declare that
my name is wrongly recorded as Mohd Javaid U In my Aadhaar Card UID
No. 9371 9578 8045. The correct name is Mohd Javaid. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Kabir Ahmed S/o Wazir Hussain R/o Village Jamola, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my daughter's name is wrongly recorded as Shashita Begum
in her Aadhaar Card UID No. 7593 1944 0461. The correct name is Shasta
Begum. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4472 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Parveen Akhter W/o Shokit Ali and D/o Sain R/o Village Targain,
Tehsil Kotranka, Sub District Budhal, District Rajouri, J&K-185233,
hereby declare that my name is wrongly recorded as Kulzam Akhter in my
Aadhaar Card UID No. 5511 4503 9287. The correct name is Parveen
Akhter. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Ashfaq S/o Abdul Rehman R/o Village Jaglanoo, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my son's name is wrongly recorded as Faisar Ashfaq in his
Aadhaar Card UID No. 6835 8810 6871. The correct name is Faisal
Ashfaq. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4473
NOTIFICATION
I, Maqbool Hussain S/o Ghulam Hussain R/o Village Shapur, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K 185233, hereby
declare that my daughter's name is wrongly recorded as Rahaina Kouser
in her Aadhaar Card UID No. 4369 6477 1400. The correct name is
Rahana Kouser. I further declare that my wife's name is wrongly recorded
as Rahmat John in my daughter's school records. The correct name is
Rehmat Jan. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Nazir S/o Faqir Mohd R/o Village Draj, Tehsil Kotranka, Sub
District Budhal, District Rajouri, J&K-185233, hereby declare that my
son's name is wrongly recorded as Tanvir Ahmed in his Aadhaar Card UID
No. 8631 4435 4777. The correct name is Tanwir Ahmed. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4474 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohd Farooq S/o Mohd Bashir R/o Village Darman (Dramman),
Tehsil Kotranka, Sub District Budhal, District Rajouri, J&K-185233,
hereby declare that my son's name is wrongly recorded as Arun Ahmed in
his Aadhaar Card UID No. 9457 8726 4590. The correct name is Hrun
Ahmed. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Ghulam Mohd S/o Jama Din R/o Village Khah, Jamola, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my name is wrongly recorded as Gula Mohd in my Aadhaar
Card UID No. 7357 6327 7963. The correct name is Ghulam Mohid. Now,
it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4475
NOTIFICATION
I, Shagufta Begum W/o Mohd Naseer R/o Village Swarl, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my son's name is wrongly recorded as Sharakat Khan in his
Aadhaar Card UID No. 8530 1170 9990. The correct name is Sharakhat
Khan. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Zubeda Begum W/o Mohd Manir R/o Village Mohra, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my son's name is wrongly recorded as Mohd Raftz in his
Aadhaar Card UID No. 5871 3167 2564. The correct name is Mohd
Raftaz. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4476 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Shanaz Akhter W/o Zafar Iqbal R/o Village Rehan (Rehean), Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my son's name is wrongly recorded as Umer Jawan in his
Aadhaar Card UID No. 7164 5459 5855. The correct name is Umar
Chouhan. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Janaid Shah S/o Nabi Shah R/o Village Samote, Tehsil Kotranka,
Sub District Budhal, District Rajouri, J&K-185233, hereby declare that
my name and DoB are wrongly recorded as Janid Shah & DoB 03-07-1986
in my Aadhaar Card UID No. 9338 4086 1605. The correct name and DoB
are Janaid Shah and 01-03-1994. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4477
NOTIFICATION
I, Saleem Akhter W/o Mohd Rafi R/o Kotranka, Tehsil Kotranka, Sub
District Budhal, District Rajouri, J&K-185233, hereby declare that my
son's name and DoB are wrongly recorded as Mohd Faizan and
03-05-2016 in his Aadhaar Card UID No. 4294 4889 0787. The correct
name and DoB are Mohd Fazan and 01-01-2015. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Javaid S/o Mohd Alam R/o (Panihad) Parori Gujjran, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my name is wrongly recorded as Mohd Javeed In my Aadhaar
Card UID No. 3226 0433 5358. The correct name is Mohd Javaid. Now,
it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4478 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohd Javeed S/o Mohd Alam R/o Parori Gujjran, Panihad, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K -185132, hereby
declare that the names of my children are wrongly recorded in their
Aadhaar Cards as (1) Incorrect Name: Tohed Javeed, Correct Name: Tohid
Javaid Aadhaar UID No. 5142 4396 6438. (2) Incorrect Name: Misbha
Javid, Correct Name: Misbha Javaid Aadhaar UID No.: 9909 5160 1350.
(3) Incorrect Name: Novid Javeed, Correct Name: Noveed Javaid Aadhaar
UID No.: 9755 3193 4321. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Razia Begum W/o Manir Hussain R/o Village Samote, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my son's name and DoB are wrongly recorded as Waheed
Ahmed and 01-01-2011 in his Aadhaar Card UID No. 4862 2893 3896.
The correct name and date of birth are Mohd Waheed and 01-02-2008.
Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4479
NOTIFICATION
I, Naseem Akhter W/o Mohd Latief R/o Kotranka, Tehsil Kotranka,
Sub District Budhal, District Rajouri, J&K-185233, hereby declare that
my son's name is wrongly recorded as Aahil Sabri in his Aadhaar Card
UID No. 4233 3637 5117. The correct name is Mohd Aahil Sabri. Now, it
needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shazreen Kouser D/o Abdul Aziz R/o Village Sawari, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185132, hereby
declare that my name is wrongly recorded as Zahida Parveen in my
Aadhaar Card UID No. 2359 7108 8034. The correct name is Shazreen
Kouser. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4480 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohammad Shafiq S/o Abdul Aziz R/o Village Larkoti, Tehsil
Kotranka, Sub District Budhal, District Rajouri, J&K-185233, hereby
declare that my name and DoB are wrongly recorded as Mohd Shafiq and
11-01-1992 in my Aadhaar Card UID No. 9499 3479 3602. The correct
name and DoB are Mohammad, Shafiq and 01-03-1994. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information to the general public that my name in Aadhaar Card
bearing No. 9172 2644 1853 has been inadvertently recorded as Rukaya
Jan instead of Ruqeia Bashir. I declare that my actual name is Ruqeia
Bashir and I intend to correct the same.
Ruqeia Bashir W/o Mohammad Yaseen Shah
R/o Harda Panzoo, Tehsil Khansahib, District Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4481
NOTIFICATION
I, Peer Reyaz Ahmad S/o Peer Noor Din R/o Usmanabad, Upper
Ashpeer, Sopore, District Baramulla, Jammu & Kashmir, hereby declare
that I have changed my name from Reyaz Ahmad Shah to Peer Reyaz
Ahmad. Henceforth, I shall be known and identified by the name Peer
Reyaz Ahmad for all purposes including educational, legal, financial,
official, and personal records. Both names pertain to one and the same
person, and there is no change in my identity except the change of name.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Haja Banoo W/o Gh Rasool Chopan R/o Kralapathri, Tehsil
Khansahib, District Budgam, Kashmir state that in my Aadhaar Card
bearing No. 6391 0207 8952, my name was wrongly written/mentioned as
Hajira Bano instead of Haja Banoo. That my actual name is Haja Banoo
in her all personal documents as on Domicile Certificate. Now, I propose
to update my name in my Aadhaar Card with the correct name is Haja
Banoo.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4482 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Aliyan Shabir S/o Shabir Ahmed R/o Baila, Tehsil Mandi, District
Poonch, do hereby declare that my actual name is Aliyan Shabir, which is
duly recorded in my 10th class marks sheet but wrongly mentioned in my
Aadhaar Card as Alyan Shabir. Now, I am applying for correction of my
name in my Aadhaar Card as Aliyan Shabir.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of the General Public that my name
in my Aadhaar Card has been wrongly entered as Showki Jan while my
correct Name is Shokey Jan. Now, I want the same to be corrected.
Shokey Jan D/o Abdul Rashid Bhat
R/o Opzan Bijbehara, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4483
NOTIFICATION
I would like to make corrections to my ward's school records currently,
my ward's name is listed as Mohammad Zuhaib, but it should be recorded
as Mohammad Zuhaib Shah, additionally, I would like to rectify the
parentage information from Javeed Ahmad Shah to Javid Ahmad Shah.
Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sushma Slathia W/o Ram Dev Singh R/o Gurha Slathia, Mandi
Rajgarh, Tehsil Vijaypur and District Samba inform to general public that
my DoB has been wrongly registered/mentioned in my Aadhaar Card
bearing No. 5285 4744 5772 as 26-06-1964 instead of 26-07-1964 which
is correct and registered in my Birth Certificate. Now, I am applying for
the correction of my DoB. in my Aadhaar Card as 26-07-1964 instead of
26-06-1964.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4484 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Shailendra Kumar Pandey S/o Jay Prakash Pandey R/o Village
Sonapakar, Bodarwar, P.O Bodarwar, District Khushinagar, Uttar
pradesh-274149 that my name has worngly written in my Aadhaar Card
bearing No. 6011 1173 3368 as Shalandar Kumar Pandey instead of
Shailendra Kumar Pandey. Now, I am applying for correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Prem Lal Verma S/o Late Sh Jai Dayal R/o House No. 27, Sec. 7
District Jammu, have applied for the correction of my name which is
wrongly written as Prem Verma in my Aadhaar Card instead of correct
name Prem Lal Verma. Now, I am apply for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4485
NOTIFICATION
I, Sugrab Singh S/o Thakur Dass R/o Gam Dighoge, Tehsil and
District Ramban have applied for correction of my Aadhaar name and DoB
and which has wrongly recorded as Sugrive Singh and DoB as 06-04-1973
and the actual name as per record is Sugrab Singh and DoB 01-05-1973
Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Prabh Dayal S/o Late Bishamber, R/o Doomi, Batehra, District
Jammu, UT of J&K, am applying for correction of my name which is
inadvertently/incorrectly written as Parbhu Dayal in my Aadhaar Card,
instead of Prabh Dayal as per the Birth Certificate of my son Master
Rajinder Manhas. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4486 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohammad Ayoub Sheikh am holding 1000 of shares of J&K Bank
Folio JKB013981, where my name has been inadvertently recorded as
Sheikh Mohd Ayoub which is incorrect. Whereas my actual name is
Mohammad Ayoub Sheikh. In this regard, I am applying for correction of
name in my Folio.
Mohammad Ayoub Sheikh S/o Ab Salam Sheikh
R/o Hazratbal Payeen, Αnantnag-192101.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Reyaz Ahmad Malik F/o Zeeshan Reyaz Malik R/o Kalantra Bla,
Baramulla, hereby declare that my son's name has been wrongly
mentioned as Zeeshan Reyaz in Aadhaar Card Bearing Aadhaar No. 9091
4647 4989. According to Birth Certificate and Borad record the correct
name of my son is Zeeshan Reyaz Malik. Now, I am applying for
correction in the Aadhaar Card records accordingly.
Keyaz Anmad Malik F/o Zeeshan Reyaz Malik
R/o Kalantra Bla, Baramulla-193101.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4487
NOTIFICATION
I, Parbeen Kumar Dogra S/o Sh. Chuni Lal R/o Ambaran, Tehsil
Akhnoor, District Jammu, PIN-181201, do hereby declare that my name
has been wrongly recorded in my Aadhaar Card and PAN Card as Parveen
Kumar instead of my correct name, Parbeen Kumar Dogra. Now, I am
applying for correction of my name in the concerned records.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar Card my wards name has been wrongly recorded as Tubia
Jan while her correct name is Toiba Nazir D/o Nazir Ahmad Wani. Now,
I want to apply for it's correction.
Nazir Ahmad Wani F/o Toiba Nazir
R/o Razloo Kund, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4488 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is to inform the general public that in Aadhar Card records my
wards name is wrongly written as Zahid Ahmad Baba instead of Zahid
Ashraf Baba and also DoB is wrongly written as 17-01-2005 instead of
16-05-2009. Now, I want to apply for its correction.
Mohammad Ashraf Baba F/o Zahid Ashraf Baba
R/o Aripora Turkawangan, Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
wards name is wrongly written as Tuibah Jan instead of Toiba Shabir and
also DoB is wrongly written as 01-03-2014 instead of 10-05-2014. Now,
I want to apply for its correction.
Shabir Ahmad Kumar F/o Toiba Shabir
R/o Trukawangam, Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4489
NOTIFICATION
I, Parveda Akhtar W/o Amir Ahmad Manhas R/o Shadab Karewa,
Tehsil & District Shopian, hereby notify that my name has been wrongly
recorded as Fareda Akhtar in my Aadhaar Card bearing No. 9821 2283
3837. My correct and actual name is Parveda Akhtar. Now, it needs
correction.
Parveda Akhtar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
name is wrongly written as Mohd Assan Mir instead of Gulam Ahsan Mir
and also Parentage is wrongly written as Ab Gaffar Mir instead of Kh. Ab.
Gaffar Mir. Now, I want to apply for its correction.
Gulam Ahsan Mir S/o Kh. Ab. Gaffar Mir
R/o Chitragam, Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4490 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
Notice is hereby given to the general public that my name has been
inadvertently recorded as Mohammad Amin Sodagar in my Aadhaar Card
bearing Aadhaar No. 8507 5231 9997 which is incorrect. My actual and
correct name is Mohd Amin Sodager S/o Gh Mohi-Ud Din Sodager R/o
Arhama, Tehsil & District Shopian, as recorded in my service records and
school records. This notice is being published to affirm my correct name
and parentage and to facilitate correction of the same in my Aadhaar
records and all other official records, wherever applicable.
Mohd Amin Sodager S/o Gh Mohi-Ud Din Sodager
R/o Arhama, Tehsil & District Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
wards name is wrongly written as Mohd Zakrika instead of Mohammad
Zakariya. Now I want to apply for its correction.
Naza Akhtar M/o Mohammad Zakariya
R/o Allowpora Keegam, Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4491
NOTIFICATION
I want to correct my Aadhaar Card name bearing No. 8118 1074 0396
from Junafar Khan to Junifar Khan. Now, I am applying for the correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that in Aadhaar Card records my
wards name is wrongly written as Arooja Aijaz instead of Arooj Aijaz and
also DoB is wrongly written as 02-05-2007 instead of 01-03-2009. Now,
I want to apply for its correction.
Aijaz Ahmad Thoker F/o Arooj Aijaz
R/o Nully Poshwari Barbugh Imam Sahib, Shopian.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4492 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In Aadhaar Card my particulars has been wrongly recorded as Zara
Salman C/o Salman Shabir Lone R/o Lone Mohalla, Qazigund while my
correct Name is Lanujungla R/o Lone Mohalla, Qazigund, Kuri Gam,
Anantnag. Now, I want to apply for it's correction.
Lanujungla
R/o Lone Mohalla, Qazigund, Kuri Gam, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar Card my wards name has been wrongly recorded as
Mohammad Zaroon Nanda while bis correct name is Mohammad Salaar
Nanda. Now, I want to apply for it's correction.
Imtiyaz Ahmad Nanda F/o Mohammad Salaar Nanda
R/o Muslim Abad, KP Road, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4493
NOTIFICATION
It is informed to general public that my daughter's name has been
wrongly entered in Aadhaar Card bearing No. 9592 9496 4732 as
Nowreena Manzoor instead of Navreena Manzoor. Now, I have applying
its correction.
Manzoor Ahmad Bhat F/o Navreena Manzoor
R/o Wadipora, Tehsil Chadoora, District Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sheikh Mumtaz Ahmed S/o Sheikh Ghulam Hyder R/o Village
Chakrara, Tehsil Mandi, District Poonch, Jammu & Kashmir, state that my
name and my father's name have been incorrectly recorded in my Aadhaar
Card bearing No. 4586-1231-8845. The name appearing in the Aadhaar
Card is Mumtaz Ahmed Ghulam Hyder, whereas my correct name is
Sheikh Mumtaz Ahmed S/o Sheikh Ghulam Hyder. I have applied to the
concerned authorities for correction of my name and my father's name in
the Aadhaar Card records. Henceforth, the correct name should be read
and treated as Sheikh Mumtaz Ahmed S/o Sheikh Ghulam Hyder for all
purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4494 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mubarik Ahmad Bhat S/o Nazir Ah Bhat R/o Hangalbuch, Tehsil
Yaripora, District Kulgam state that my actual name is spelled Mubarik
Ahmad Bhat S/o Nazir Ah Bhat R/o Hangalbuch, Tehsil Yaripora, District
Kulgam, which is correct as per School records Card, due to mistake my
name was wrongly mention as Mubarak Ahmad Bhat S/o Nazir Ahmad
Bhat R/o Hangalbuch, Tehsil Yaripora, District Kulgam in my Aadhaar
Card Under No.7616 1324 0271.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Naseer Ahmad Mughal Chughta S/o Bashir Ahmad Mughal
Chughta R/o Bagna Noorkhah, Tehsil Boniyar, District Baramulla state
that the name of my daughter namely Sohana Naseer has been wrongly
written in her Aadhaar Card bearing No .4325 2947 0215 as Sunana. The
actual name of my daughter is Sohana Naseer. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4495
NOTIFICATION
I, Nittan Dhamatia S/o Sh Agha Ram Dhamatia R/o Village Shri
Partap Singh Pura, Tehsil Bishnah District Jammu have applied for
correction of my and my father's name which has been wrongly written as
Nittin Dhamahi S/o Agha Ram instead of correct name Nittan Dhamatia
S/o Agha Ram Dhamatia in my Aadhaar Card bearing No. 9740 6635
3079. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shamima Koser D/o Abdul Aziz and Zabina Koser, Caste Lohar R/o
Hari, Tehsil Surankote, District Poonch, hereby declare that my name has
been wrongly recorded as Samiya Kosser in certain documents. My correct
name is Shamima Koser. Henceforth, Shamima Koser shall be treated as
my correct name for all purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4496 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Ms Priyanka Tikoo D/o Pyare Krishan R/o H.No. 562-D, Back side
Royal Nest Flat, near BJP Office-180020 declare that after my marriage,
my surname was changed from Tikoo to Sharma and my name came to be
recorded as Priyanka Sharma in various official records and documents.
My marriage was dissolved by a decree of divorce on 11 August, 2018.
Now, after my divorce, I have decided to resume and use my maiden
surname Tikoo instead of Sharma. I also wish to have my status corrected
from Wife of Suresh Sharma to Daughter of Pyare Krishan in all my
documents and records, wherever applicable.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohammad Qasim Doie F/o Usman Qasim Doie R/o Lidroo, Tehsil
Pahalgam, District Anantnag state that my ward namely Usman Qasim
Doie S/o Mohammad Qasim Doie. My ward is having an Aadhaar Card
bearing No. 5342 7700 8776. My ward's name has been wrongly
mentioned in her Aadhaar Card as Usmeen Asim instead of Usman Qasim
Doie. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4497
NOTIFICATION
It is information for general public that my daughters name has been
wrongly Mentioned in her Aadhaar Card as Sabhat Riyaz D/o Riyaz
Ahmad Mir instead of Sabia Reyaz D/o Reyaz Ahmad Mir. Therefore, I
wanted to change.
Reyaz Ahmad Mir F/o Sabia Reyaz
R/o Surasyar Chadoora, Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to general public, that my ward's name has been
wrongly mentioned in his/her Aadhaar Card as Ashiya Ashiq instead of
Ayesha Ashiq. Now, it needs correction.
Ashiq Hussain Dar F/o Ayesha Ashiq
R/o Kashmiri Manigah, Tehsil & District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4498 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In my Aadhaar Card bearing No. 6000 3066 2349, my name has been
wrongly admitted as Mahetabh Irshad while as my actual name is written
as Mahietabah Jan also my actual DoB is 06/09/2003 instead of
14/12/2001. Now, I am applying for its correction.
Mahietabah Jan D/o Irshad Hussain Lone
R/o Botingoo, Tehsil Dangerpora, District Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Arshad Hussain Shah F/o Musharif Hussain Shah R/o Gundi
Saydan, Karnah Kupwara state that my son’s name has been wrongly
mentioned as Mushorif Hussain Shah in Aadhaar records. The correct
name is Musharif Hussain Shah. Now, I am applying for correction.
Arshad Hussain Shah F/o Musharif Hussain Shah
R/o Gundi Saydan Karnah, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4499
NOTIFICATION
I, Rinku S/o Roshan Lal R/o 6 JRK Hanumangarh, Rajasthan presently
residing at Channi Himmat, Bhalla Enclave state that I want correction in
my name. At present, in all my legal and official records my name is Rinku
and I want it to be corrected as Rinku Joriya.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to general public, that my name has been wrongly
mentioned in my Aadhaar Card as Mahmooda Begum instead of
Mohamoda Begum as per domicile. Now, it needs correction.
Mohamoda Begum W/o Mohd Sidiq Dar
R/o Haihama Payerpora, Tehsil & District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4500 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is information for general public that my name and address has been
wrongly mentioned in my Aadhaar card bearing No. 6256 1874 6333 as
Tobia Shafi D/o Mohammad Shafi Gojri, Address Wathora Sheikhpora,
VTC Auwanpora instead Toiba Shafi D/o Mohammad Shafi Gojri R/o
Sheikhpora, Wathora. Now, I wanted to change it.
Toiba Shafi D/o Mohammad Shafi Gojri
R/o Sheikpora Wathora, Chadoora, Budgam, Ph. 9622776722.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is information for general public that my daughter’s name has
been wrongly enter in Aadhaar Card under No. 6122 1180 1284 as Jofly
Akhter instead of Jofey Akhter. Now, I want to its correction.
Gh Mohammad Mir F/o Jofey Akhter
R/o Surasyar, Tehsil Chadoora, District Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4501
NOTIFICATION
It is here informed to general public that my son’s name has been
wrongly mentioned in his Aadhaar Card vide No. 6512 0031 1323 as
Fawat Farooz instead of Fawad Farooz. Therefore, I want correct his name
in Aadhaar.
Farooz Ahmad Para F/o Fawad Farooq
R/o Surasyar Chadoora, Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In Aadhaar recoard bearing No. 4520 4816 6109 my name recorded
as Mohammad Haneef Goursi instead of Mohd Hanif Gorsi. Now, it needs
correction.
Mohd Hanif Gorsi S/o Mohd Asgar Gorsi
R/o Nandimarg, Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4502 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is inform the general public that my name has been wrongly
recorded as Mohammad Akbar Ganai instead of Shabir Ahmad Ganaie and
DoB 01-01-1950 instead of 25-04-1984 in my Aadhaar Card bearing No.
3691 6705 7797. Now, I want to apply for the correction.
Shabir Ahmad Ganaie S/o Mohammad Akbar Ganai
R/o Khuserpora, Hajin.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my daughter issued vide No. 2082 8111 1349,
her name has been enrolled as Madiha Riyaz instead of Madiha Jaan. Now,
I want to apply for it's correction.
Mudasir Ara W/o Late Riyaz Ahmad Malik
R/o Delina Ghat, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4503
NOTIFICATION
I, Megha D/o Lakhpal R/o Christian Colony, Vir Marg, Jammu have
changed my name Salma Begum which I attained at the time of my
marriage with Feroz Ahmed S/o Abdul Samad R/o Gool, District Ramban.
Now, I have got divorce from the above said Feroz Ahmed and have
attained my before marriage name Megha. Now, I want this to be updated.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of the General Public that my name
in my Aadhaar Card has been wrongly entered as Haneefa Banoo W/o
Zahoor Ahmad Khatana while my correct name is Hanifa Banoo W/o
Zahoor Ahmad Khatana R/o Dandipora, Larnoo, Anantnag. Now, I want
the same to be corrected.
Hanifa Banoo W/o Zahoor Ahmad Khatana
R/o Dandipora Larnoo, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4504 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I want to correct the name of my ward in Aadhaar Card from Inza
Imtiyaz to Fatima Bin Imtiyaz. Now, I am applying for its correction.
Imtiyaz Ahmad Bhat F/o Fatima Bin Imtiyaz
R/o Kreeri Dooru, District Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my daughter issued vide No. 2992 9083 1496,
her name has been enrolled as Sadrat ul Muntaha instead of Sidratul
Muntaha. Now, I want to apply for it's correction.
Mudasir Ara W/o Late Riyaz Ahmad Malik
R/o Delina Ghat, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4505
NOTIFICATION
I want to correct the name of my son in Aadhaar Card bearing No.
7939 3709 5728 from Burhan Bashir to Sehran Ahmad Malik. Now, I am
applying for its correction.
Bashir Ahmad Malik F/o Sehran Ahmad Malik
R/o Ringat DH Pora, District Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct the name of my son in Aadhaar Card bearing No.
8942 3489 1610 from Schran Malik to Burhan Bashir Malik. Now, I am
applying for its correction.
Bashir Ahmad Malik F/o Burhan Bashir Malik
R/o Ringat DH Pora, District Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4506 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is inform to the general public that my name and DoB has been
wrongly mentioned in my Aadhaar as Shafqat Yousuf & DoB 25-05-2014
while as my actual name and DoB is Zainab Yousuf & DoB 17-06-2013
C/o Mohammad Yousuf Gujjar Chichee R/o Laderwan, Tehsil Trehgam,
District Kupwara-193224. Now, I want to apply for the correction of the
same.
Zainab Yousuf C/o Mohammad Yousuf Gujjar Chichee
R/o Laderwan, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I have changed my name from (old name) Ammad Altaf Lone to (new
name) Immad Altaf Lone. In future, I will be known as (new name) Immad
Altaf Lone.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4507
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar Card bearing No. 6273 0543 8990. Now, I want
to change my name from Benazir Ali (old name) to Bainazeer Ali (new
name).
Bainazeer Ali D/o Ali Mohammad Sheikh
R/o Ranger, Badgam, Jammu and Kashmir-191113.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar Card bearing No. 3659 5583 2235. Now, I want
to change my name from Abdul Ahad Sheikh (old name) to Ahadoo
Shiekh Mochi (new name).
Ahadoo Shiekh Mochi C/o Ghulam Mohammad Sheikh
R/o Palpora, Parimpora, Srinagar, Jammu and Kashmir-190017.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4508 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar Card bearing No. 4011 9073 4008. Now, I want
to change my name from Sabeena (old name) to Shubeena malik (new
name).
Shubeena Malik D/o Ghulam Mohammad Malik
R/o Karfali Mohalla, Habba Kadal, Jammu and Kashmir-190001.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar Card bearing No. 4513 5719 1127. Now, I want
to change my name from Abdul Manan Pandaw (old name) to Khalid Bin
Firdous (new name).
Khalid Bin Firdous S/o Firdous Ahmad Pandaw
R/o Bul Bul Lanker, Jammu and Kashmir-190002.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4509
NOTIFICATION
I want to correct my name in Aadhaar Card bearing No. 7864 0662
4835 from Zubaida Beigh to Zubida Beigh. Now, I am applying for
correction.
Zubida Beigh
R/o House No. 51, Pine Enclave Sanat Nagar, Srinagar, Jammu and
Kashmuir-190005.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card vide No. 9288 0245 9722, my wards name has
been enrolled as Mohmmad Idrees Teli instead of Mohmmad Idrees. Now,
I want to apply for it's correction.
Mohmmad Idrees
R/o Wathora, Chadoora, District Budgam, Jammu and Kashmir-191113.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4510 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is notified for the information of the General Public that my ward's
name & DoB in Aadhaar Card has been wrongly entered as Suzmmia
Shabir & 25-07-2013 while my ward's correct Name & DoB is Suzaima
Shabir & 12-04-2015. Now, I want the same to be corrected.
Masrat Jan M/o Suzaima Shabir
R/o Nipora, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information for general public that my name has been wrongly
mentioned in my Aadhaar Card vide No. 6947 2781 2705 as Gull Mohd
Mochi instead of Gull Mohammad Mochi. Therefore, I want to correct my
name in Aadhaar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4511
NOTIFICATION
I, Showkeey Jan D/o Mohammad Sadiq Drangi R/o Brinty Batpora,
Tehsil and District Anantag, state that my name has been incorrectly
mentioned in Aadhaar card as Shokey Jan whileas my correct name is
Showkeey Jan, which is recorded correctly in my supporting documents
such as Domocile and other documents. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my ward issued vide No. 4813 6232 6886, his
name has been enrolled as Zehraan Mehraj instead of Zahraan Mehraj.
Now, I want to apply for it's correction.
Zahraan Mehraj C/o Mehraj U Din Awan
R/o Kangroosa, Baramulla, Jammu and Kashmir-193303.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4512 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is to inform the general public that the name of my daughter has
been inadvertently recorded in her Aadhaar Card as Halena Jan, which is
incorrect. Her correct and actual name is Alina Riyaz. Both the names refer
to one and the same person. Now, it needs correction.
Riyaz Ahmad Awan F/o Alina Riyaz
R/o Pehlipora, Tehsil Keller, District Shopian, J&K (UT).
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned on Aadhaar Card as Sayeeda Bano instead of Sayeeda Begom
Now, I want to apply for its correction.
Sayeeda Begam W/o Altaf Hussain
R/o Prada Karnah, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4513
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar Card bearing No. 2167 0148 3539. Now, I want
to change my name from Hazia Gulzar (old name) to Bisma Gulzar (new
name).
Bisma Gulzar D/o Gulzar Ahmad Wava
R/o Und Masjid Khanyar, Sriangar, Jammu and Kashmir 190002.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhaar Card of my ward issued vide No. 8827 3581 9054, her
name has been enrolled as Rabiya Nazir instead of Rafiya Nazir. Now, I
want to apply for it's correction.
Nazir Ahmad Ganaie F/o Rafiya Nazir
R/o Peth Kanihama, District Badgam, Jammu and Kashmir-193401.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4514 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is hereby notified for the information of the general public that my
DoB recorded in my Aadhaar Card bearing No. 2655 2280 0391 is
incorrectly mentioned as 12-12-1965 instead of my correct and actual DoB
as per my Date of Birth Certificate, which is 12-12-1974. This requires
correction.
Fatima Bano W/o Abdul Majeed Wani D/o Abdul Aziz Wani
R/o Prang, Kangan, Ganderbal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Satia Devi W/o Sh Charan Dass R/o Kachrial, Tehsil Khour and
District Jammu, have applied for the correction of my name & DoB which
has wrongly mentioned in Aadhar Card as Satya Devi & DoB 20-05-1948
instead of Satia Devi and DoB-15-09-1948. Now, I am going to apply for
the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4515
NOTIFICATION
I, Mushtaq Ahmad Shah S/o Late Nabi Shah R/o Darapora (Lolab),
Tehsil Lalpora, hereby state that my ward's name has been wrongly
entered in the Aadhaar Card as Aadil Mushtaq Shah instead of Shah Aadil
Mushtaq. Now, I intend to correct my ward's name as Shah Aadil Mushtaq
instead of Aadil Mushtaq Shah in all relevant records.
Mushtaq Ahmad Shah F/o Shah Aadil Mushtaq
R/o Darapora, Lolab Tehsil Lalpora, PIN-193223.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mahender Kour W/o Chanda Singh R/o Village Shamachack, Tehsil
Marheen, District Kathua, U.T. of J&K, state that as per Aadhaar Card,
my name has been written as Mindo Devi, while on the ECHS Card/Army
records, my name has been written as Mahender Kour which is correct.
Therefore, correct name is Mahender Kour instead of Mindo Devi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4516 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Maireena Bano D/o Mohammad Maqbool Bhat, R/o Bichi, Tehsil
Boniyar, District Baramulla, Jammu & Kashmir, state that due to a
clerical/typographical error, my name has been wrongly recorded in my
Aadhaar as Mahreena Bano instead of my correct name Maireena Bano.
Now, I want the same to be corrected.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct my name and parentage in my Aadhaar card bearing
No. 8812 4174 2874 from Mahreen Naseer S/o Jabeena Begum to Mehran
Naseer Doond S/o Naseer Ahmad Doond. Now, I am applying for its
correction.
Mehran Naseer Doond S/o Naseer Ahmad Doond
R/o Shaladajan, Nowsheera.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4517
NOTIFICATION
It is hereby informed to the general public that my name and DoB have
been incorrectly recorded in my Aadhaar Card as Mohammad Hafeez and
04-10-2002. My correct particulars are Mohammad Hafiz Bhat S/o Abdul
Majid Bhat R/o Nambla, Tehsil Uri, District Baramulla, J&K, correct DoB
15-03-2002. Now, it needs correction.
Mohammad Hafiz Bhat.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Namo Devi W/o Ram Singh R/o Village Jindlehar, Tehsil RS Pura,
District Jammu, my name has been wrongly written in my Aadhaar Card
No. 7757 4640 1096 as Nahamo Devi instead Namo Devi. Now, I am
applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4518 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Farooq Ahmad Lone F/o Sajad Ahmad Lone R/o Guzriyal state that
my son's name has been wrongly mentioned in Aadhaar Card vide No.
4462 8608 4197 as Haris Farooq S/o Farooq Ahmad Lone instead of Sajad
Ahmad Lone S/o Farooq Ahmad Lone. Now, I want to correct this.
Farooq Ahmad Lone F/o Sajad Ahmad Lone
R/o Guzriyal.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Sadiq S/o Abdul Ahad Wani R/o Uri, Tehsil Uri, District
Baramulla, UT of J&K, state that my name has been wrongly recorded in
my Aadhaar Card bearing No. 8411 7977 5091 as Mohd Sadeeq Wani S/o
Abdul Ahad Wani. My correct name and parentage are Mohd Sadiq S/o
Abdul Ahad Wani. Henceforth, I shall be known and identified by the
name Mohd Sadiq S/ o Abdul Ahad Wani for all official, legal, and
administrative purposes.
Mohd Sadiq S/o Abdul Ahad Wani
R/o Uri, Tehsil Uri, District Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4519
NOTIFICATION
I have changed my name from (old name) Mahmooda Akhtar to (new
name) Mehmooda Akther. In future, I will be known as (new name)
Mehmooda Akther.
Mehmooda Akther W/o Mukhtar Ahmad Mir
R/o Bandgam Budgam Cell. 9906532311.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to general public, that my wards name & DoB has been
wrongly mentioned in his Aadhaar Cards as (1) Mahraj Ismaiel S/o
Mohammad Ismail Dar DoB 14-04-2018 instead of Mehraj Ahmad Dar
DoB 01-03-2018 (2) Rafit Ismail DoB 01-03-2012 instead of Rifat Jaan
DoB 15-10-2013. Now, it needs correction.
Mohammad Ismail dar F/o Mehraj Ahmad dar & Rifat Jaan.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4520 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I have changed my name from (old name) Mohd Hussain to (new
name) Mohammad Hussain Kaloo. In future, I will be known as (new
name) Mohammad Hussain Kaloo.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I have changed my name from (old name) Syed Tariq Ahmad Indrabi
to (new name) Syed Mohammad Tariq Andrabi. In future, I will be known
as (new name) Syed Mohammad Tariq Andrabi.
Syed Mohammad Tariq Andrabi S/o Syed Mohammad Maqbool Andrabi
R/o Malik Manzil, Magermal Bagh, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4521
NOTIFICATION
In my Aadhaar Card bearing No. 5590 2209 3899, my name has been
enrolled as Gh Quadir Butt instead of Gulam Qadir Butt. Now, I want to
apply for it's correction.
Gulam Qadir Butt S/o Habib Butt
R/o Naganari Boniyar, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In my Aadhaar Card bearing No. 7255 7797 6032, my name has been
enrolled as Ashiq Hussain Dar instead of Ashaq Hussain Dar. Now, I want
to apply for it's correction.
Ashaq Hussain Dar S/o Abdul Rahim Dar
R/o Sheeri Narvaw, Baramulla.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4522 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is for the information that my name and parentage on my passport
have been wrongly mentioned as Muneer Ahmad Bhat S/o Ghulam
Mohmmad Bhat instead of Muneer Ahmad S/o Ghulam Mohmad Bhat.
Now, the same needs to be rectified.
Muneer Ahmad S/o Ghulam Mohmad Bhat
R/o Shagi Mohalla Soura, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Qamriya Mukhtar D/o Mukhtar Ahmad Kaloo R/o Barbarshah
Baghwanpura, Srinagar, J&K, India state that I was issued a passport
bearing Passport No. R4519146 in the name of Qamriya Akhtar, Father's
Name as Mohd Wahid Dar and Mother's Name as Sumaire, which stands
expired. My actual name as per my educational records is Qamriya
Mukhtar, having correct father's name as Mukhtar Ahmad Kaloo and
mother's name as Shaida Mukhtar. Qamriya Akhtar and Qamriya Mukhtar
is one and the same person, and I solicit this notice for correcting my name
as Qamriya Mukhtar in my fresh passport, with correct father's name as
Mukhtar Ahmad Kaloo and mother's name as Shaida Mukhtar, in order to
avoid any confusion in future.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4523
NOTIFICATION
I, Santosh Khajuria D/o Mouj Sharn R/o H. No. 85, Malhotra Street,
Jammu have applied for correction of my name in J&K Bank Passbook
which has been wrongly written as Santosh instead of Santosh Khajuria.
Now I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I want to correct the father's name of my daughter Fatima Younis class
11th Roll No. 13129816 in her School Records at Central Board of School
Education and Delhi Public School, Srinagar from Mohd Younis Jan to
Mohammad Younis Jan. Now, the same is to be corrected.
Umera Habib M/o Fatima Younis
R/o Batamaloo, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4524 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
General public through the medium of this Notice is informed that my
actual/real name is Bandhna Devi and inadvertently it has been written as
Bandhana Devi on my Aadhaar Card No. 6649 1049 3888. Now, I am
applying for the name correction of my Aadhaar Card.
Bandhna Devi
R/o Ind Gool, Ramban, (J&K) PIN-182144.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Amarjeet Kour W/o Late Sh Surjeet Singh R/o Mottay Motha,
Tehsil R.S. Pura, District Jammu (J&K) - 181102, state that my name has
been wrongly recorded as Amarjeet Kour in my Aadhaar, Voter ID and
Ration Card. My correct name as per school records is Makhna Devi. I
further declare that Amarjeet Kour and Makhna Devi is one and the same
person. Henceforth I shall be known as Makhna Devi for all purposes.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4525
NOTIFICATION
I, Shivaay S/o Sh Bharat Bhushan R/o H. No. 65, Dogra Hall, Jammu,
stated that my name have wrongly been written as Shivaay (incorrect)
instead of Shivoy Bhagat (correct) in my Aadhaar Card. Now, I am
applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information for general public that my name has been wrongly
mentioned in my Aadhaar Card vide No. 2237 0014 7465 as Ghulam
Mohammad Bhat instead of Gh Mohammad Darzi. Therefore, I want to
correct my name in Aadhaar.
Gh Mohammad Darzi S/o Abdul Salam Bhat
R/o Jawahir Nagar, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4526 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in the Aadhaar records as Shubeena Akther instead of Shabeena
Akhter. My DoB is also incorrectly recorded as 14-04-2002 instead of
10-04-2002. Now, I am now applying for the correction of the same.
Shabeena Akhter D/o Mohammad Qasim Dar (Gojar)
R/o Pindobal Devalgam, Kokernag, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to the general public that my name has been wrongly
written in Aadhaar records as Kulsuma Banoo instead of Kulsoom Akhter
and also DoB is wrongly written as 18-07-1986 instead of 25-01-1983.
Now, I am apply for its correction of the same.
Kulsoom Akhter W/o Mohd Ashraf Dar
R/o Pindobal, Devalgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4527
NOTIFICATION
In the Aadhaar Card of my ward issued vide No. 9678 4210 2829, her
name has been enrolled as Tabasum instead of Taqwah Aziz. Now, I want
to apply for it's correction.
Abdul Aziz Guroo F/o Taqwah Aziz
R/o Padshahi Bagh Kursoo, Sriangar, Jammu and Kashmir-190008.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is an information for general public that in my Aadhaar Card
bearing No. 2567 8270 2804, my name, Parentage and Address has been
mentioned as Shaheena Bano D/o Abdul Aziz Malla R/o Arin Dardpora.
Now, I want to apply for change my name, parentage and address, because
of my marriage in other Area and as per my Domicile Certificate as
Shamima Begum W/o Tanveer Ahmad Malik R/o Chithay Bandi,
Bandipora.
Shamima Begum W/o Tanveer Ahmad Malik
R/o Chithay Bandi, Tehsil & District Bandipora, Jammu and
Kashmir, India, Pin Code-193502.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4528 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my Aadhaar as Jawahira Bano while as my actual name is
Jawahara Bano C/o Mohmmad Abdullah Lone R/o Lashtiyal Kalaroose,
District Kupwara-193222. Now I want to apply for the correction of the
same.
Jawahara Bano C/o Mohmmad Abdullah Lone
R/o Lashtiyal Kalaroose, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is notified for the information of the general public that my name in
my Aadhaar Card has been wrongly entered as Jahangir Ahmed Bhat while
my correct Name is Jehangir Ahmad Bhat. Now, I want the same to be
corrected.
Jehangir Ahmad Bhat S/o Bashir Ahmed Bhat
R/o Panchpora Bijbehara, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4529
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my Aadhaar as Asma Jan while as my actual name is Asmat
Jaan C/o Ghulam Mohiudin Bhat R/o Tarathpora, Kupwara, District
Kupwara-193224. Now, I want to apply for the correction of the same.
Asmat Jaan C/o Ghulam Mohiudin Bhat
R/o Tarathpora, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Jeet Kumar S/o Neel Kanth R/o Kathar, Tehsil Mehra Mandrian,
District Jammu have applied for the correction of mother's name which
has been wrongly written as Jyoti Devi instead of correct name Jeeto Devi
in the manual birth certificate of my daughter namely Hemani Sharma
whose DoB is 29-10-2015 registered vide Regn. No. 1906 dated 16-11-
2015 and issuance of new digital (computerised) birth certificate in her
favour. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4530 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Gursimran Kour (new name) previously known as Ganeshi Devi
(old name) DoB-02-06-1989 D/o Kartar Singh R/o Pinger Bainsta,
Udhampur, Pincode-182126 have applied for the change/update of my
name from Ganeshi Devi to Gursimran Kour in my Aadhaar Card bearing
No. 9255 8838 5202. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Aftab Ahmed S/o Mohd Azam R/o Eid Gah Road, Nikki Mohalla
Sidhra ,Jammu have applied for the correction of my daughter’s name
which has been wrongly written as Haleema Aftab instead of correct name
Haleema Sadia and DoB which has been wrongly written as 01-01-2008
instead of correct DoB 03-01-2009 in her Aadhaar Card. Now, I am
applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4531
NOTIFICATION
I, Jamila Begum W/o Mohammad Iqbal R/o Khellani, Tehsil &
District Doda my name was wrongly written as Jameerla Begum instead
of Jamila Begum in my Aadhaar Card Record. Now, I am applying for its
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my Aadhaar as Humaira while as my actual name is Mahira
Jan C/o Javid Ahmad Tedva R/o Methabagh Kalarooch, Kupwara, District
Kupwara-193222. Now, I want to apply for the correction of the same.
Mahira Jan C/o Javid Ahmad Tedva
R/o Methabagh Kalarooch, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4532 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Jigmath Choskith D/o Sh Thinly Tundup R/o Kisherak Ufti Pipiting,
Tehsil Zanskar, District Kargil, UT Ladakh, do hereby declare that my
name has been wrongly written in my Aadhaar Card bearing No. 3399
4384 0014 as Jakmat Cheskit instead of my correct name is Jigmath
Choskith. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my Aadhaar as Shanaza while as my actual name is
Shahnaaz Malik C/o Shakoor Ahmad Malik R/o Kalaroose Kupwara,
District Kupwara-193222. Now, I want to apply for the correction of the
same.
Shahnaaz Malik C/o Shakoor Ahmad Malik
R/o Kalaroose, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4533
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my Aadhaar as Abeed Ul Islam while as my actual name is
Adeeb Ul Islam C/o Gh Mohiudin Goger Katari R/o Kuligam, Kupwara,
District Kupwara-193223. Now, I want to apply the correction of the same.
Adeeb Ul Islam C/o Gh Mohiudin Goger Katari
R/o Kuligam, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my Aadhaar as Aafiya Bano while as my actual name is
Auffya Manzoor C/o Manzoor Ahmad Bhat R/o Kukroosa, Kupwara,
District Kupwara-193224. Now, I want to apply for its correction.
Aufiya Manzoor C/o Manzoor Ahmad Bhat
R/o Kukroosa, Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4534 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
This is inform to the general public that my name has been wrongly
mentioned in my aadhaar as Shail Khatana while as my actual name is
Furkan Ahmad Gojer Khatana C/o Akbar Din Gojer Khatana R/o Nagsar
Kalaroose, Kupwara, District Kupwara-193222. Now, I want to apply for
the correction of the same.
Furkan Ahmad Gojer Khatana C/o Akbar Din Gojer Khatana.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information for general public that my name and DoB has been
wrongly mentioned in Aadhaar Card bearing No. 8080 6733 4689 as
Waseem Ahmad Naik DoB 01-01-2007 instead of Mohammad Waseem
Naik DoB is 10-02-2009. Now, I am applying for its correction.
Mohammad Waseem Naik S/o Fayaz Ahmad Naik
R/o Badijahallan, Tehsil D.H.Pora, District Kulgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4535
NOTIFICATION
I, Shoaib Ahmed Khan Kashi S/o Mohammad Asif Khan Kashi R/o
Badiyari House, Buchwara, Dalgate, Hanfia Masjid, Srinagar, inform the
general public that I have changed my name from (old name) Mohamad
Shoaib Khankashi to (new name) Shoaib Ahmed Khan Kashi. In future, I
will be known as (new name) Shoaib Ahmed Khan Kashi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohamed Rafiq S/o Saain Khan R/o Manial, Tehsil Thanamandi,
District Rajouri applying for correction of my name & my father’s name
which is wrongly written as Mohd Rafiq S/o Sain Khan instead of correct
Mohamed Rafiq S/o Saain Khan in my Aadhaar Card bearing No. 8854
2307 1896. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4536 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In the Aadhaar Card of my ward issued vide No. 7550 5923 7612, his
name has been enrolled as Mohammad Ziyan instead of Ahmad Shafi Dar.
Now, I want to apply for it's correction.
Ahmad Shafi Dar C/o Mohammad Shafi Dar
R/o Mallapora Rainawari, Srinagar, Jammu and Kashmir-190003.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In the Aadhar Card vide Aadhar No. 3901 8243 4122, my name has
been enrolled as Kasir Ahmad Rather instead of Kaiser Ahmad Rather.
Now, I want to apply for it's correction.
Kaiser Ahmad Rather S/o Manzoor Ahmad Rather
R/o Rukh Gund Macher, District Kupwara, Jammu and Kashmir.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4537
NOTIFICATION
My wards name has been wrongly mentioned in his Aadhaar Card
bearing No. 5886 2305 7462 as Sumair Ahmad Dar instead of Sameer
Ahmad Dar. Now, I want its correction.
Nazir Ahmad Dar F/o Sameer Ahmad Dar
R/o Surasyar Chadoora, Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is information for general public that my name has been wrongly
mentioned in my Aadhaar card vide No. 7962 5533 3544 as Ahmer
Mushtaq instead of Ahmer Mushtaq Khan. Therefore, I want to correct my
name in Aadhaar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4538 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is information for general public that my name has been wrongly
mentioned in my Aadhaar Card vide No. 4146 9642 1965 as Firdous
Ahmad Zia instead of Firdoos Ahmed Zai. Therefore, I want to correct my
name in Aadhaar.
Firdoos Ahmed Zai
R/o Budshah Nagar, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is to inform the general public that my name has been wrongly
mentioned in my Aadhaar Card bearing No. 9915 2841 3658. Now, I want
to change my name from Shakur Ali (old name) to Sukur Ali (new name).
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4539
NOTIFICATION
It is information for general public that my name has been wrongly
mentioned in my Aadhar Card vide No. 7503 6791 6238 as Rahmi Bano
instead of Rehmat. Therefore, I want to correct my name in Aadhaar.
Rehmat D/o Ismai Ganie
R/o Alamdar Colony Bogam, Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
In my Aadhaar Card bearing No. 2414 5093 5665 my name is recorded
as Mohammad Yaqoob Zeengar while as my correct name is Mohd
Yaqoob Zeengar. Now the same is to corrected.
Mohd Yaqoob Zeengar D/o Abdul Rehman Zeengar
R/o Abu Bakar Colony Bemina, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4540 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Momen Zahoor Lone S/o Zahoor Ahmad Lone R/o Chotipora,
Achabal, Sopore, District Baramulla, Jammu & Kashmir, state that my
name has been incorrectly recorded in my Aadhaar Card bearing No. 8647
2436 1584 as Momin Zahoor instead of my correct name, Momen Zahoor
Lone. Now, I intend to apply for correction of my name in the Aadhaar
records to reflect my correct name as Momen Zahoor Lone.
Momen Zahoor Lone S/o Zahoor Ahmad Lone
R/o Chotipora, Achabal, Sopore, District Baramulla, Jammu & Kashmir.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sneha Gupta D/o Ramesh Kumar Gupta R/o Swankha Morh,
Channiman Hassan, Tehsil Vijaypur & District Samba, JK-UT, that I want
to change my daughters name from Parveen Gulati to Nayesha Gupta in
her Aadhaar Card bearing No. 9864 4973 3535. Now, I am applying for
correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4541
NOTIFICATION
I, Javed Iqball S/o Sabar Hussain R/o Dhalyote Tehsil Kalakote,
District Rajouri state that my name has been wrongly recorded in my
Aadhaar Card as Javed Iqbal whileas my correct name is Javed Iqball.
Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is informed to the general public that the name of my daughter has
been wrongly mentioned in Aadhaar Card bearing No. 4008 0788 2263 as
Malik Afeerah Fayaz instead of Epheeriah Malik. Now, I am applying for
its correction.
Fayaz Ahmad Malik F/o Epheeriah Malik
R/o Trich, Pulwama.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4542 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Gulzar Ahmed S/o Abdul Rashid Manhas R/o Gundi, Tehsil Gool,
District Ramban applying for correction of my son's name which is
wrongly written as Adiyan Hussain instead of correct Adyan Gulzar in his
Aadhaar Card bearing No. 7474 3496 4573. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Reeta Devi W/o Doulat Ram R/o Village Pukharni, Tehsil Kharah
Balli, District Jammu applying for correction of my name which is
wrongly written as Reeta Sharma instead of correct Reeta Devi in Aadhaar
Card bearing No. 4941-0716-3779. Now, I am applying for its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4543
NOTIFICATION
I, Shagufta Bano W/o Abrar Ahmed R/o Gool, Tehsil Gool, District
Ramban applying for correction of my daughter's name which is wrongly
written as Aidah Abrar instead of correct Ahida Abrar in her Aadhaar Card
bearing No. 9943 8540 9296. Now, it need correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Bilo Devi W/o Bansi Lal R/o Lower Dalwah, Tehsil Gool, District
Ramban, am applying for correction of the names of my children which
are wrongly written/recorded in their Aadhaar Cards as Manget Ram
(incorrect) instead of the correct name Mangat Ram bearing Aadhaar No.
3481 9955 0571, Raksh Kumar (incorrect) instead of the correct name
Rakesh Kumar bearing Aadhaar No. 7646 4800 2280, and Rachana Devi
(incorrect) instead of the correct name Rachna Devi bearing Aadhaar No.
4948 3146 8753, and in all other official records/documents, wherever
applicable. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4544 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Mohd Aslam S/o Mohd Shafi R/o Jabra, Mahakund, Tehsil Gool,
District Ramban applying for correction of my son's name which is
wrongly written as Mohd Sajeed instead of correct Mohd Sajjad in his
Aadhaar card bearing No. 7028 8081 7166. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Abdul Majid S/o Abdul Hamid R/o Gundi Dharam, Tehsil Gool,
District Ramban applying for correction of my daughter's name which is
wrongly written as Shahira Bano instead of correct Saira Bano in her
Aadhaar card bearing No. 8083 1636 1124. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4545
NOTIFICATION
I, Mohd Arif S/o Mehrak Shah R/o Gagarsullah, Gundi, Tehsil Gool,
District Ramban applying for correction of my son's name which is
wrongly written as Sayed Burhan instead of correct Syed Burhan in his
Aadhaar card bearing No. 3709 0624 6895. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mohd Zabbi S/o Hassan Mohd R/o Village Rajnagar, Tehsil
Kotranka (Budhal), District Rajouri, applying for correction of my
daughter's name which are wrongly written as Shamyia Kosser D/o Mohd
Mushtaq instead of correct Shamyla Kousser D/o Mohd Zabbi in her
Aadhaar Card bearing No. 3000 3020 4074. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4546 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Tasmeen Begum W/o Mohd Bashir R/o Gulabpura, Tehsil
Chassana, District Reasi, applying for correction of my name and DoB
which are wrongly written as Taso Begum & DoB 14-06-1988 instead of
correct Tasmeen Begum & DoB 03-04-1992 in State Bank of India Branch
Budhal. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I Pawan Kumar S/o Charan Dass R/o Village Daruie, Tehsil & District
Samba. The correct name of my son is Vipan Sharma which has been
wrongly written as Vipin Sharma in his Aadhaar Card bearing No. 2575
3871 8289. Now I am applying for the necessary correction in the name.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4547
NOTIFICATION
L, Premilla Sharma W/o Alyat Chand Sharma R/o Bhandera
Kuntwara, Tehsil Drabshalla, District Kishtwar applying for correction of
my daughter's name which is wrongly written as Isha Sharma instead of
correct name Esha Sharma in Aadhaar Card bearing No. 4580-3073-3265
and another daughter's name wrongly written as Nandika Sharma instead
of correct Prakriti Sharma in Aadhaar Card bearing No. 7305-1779-4878.
Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Shabina Jameel Mir D/o Mohd Amin Mir R/o Degwar Tarwan,
Tehsil Haveli, District Poonch applying for correction of my name which
is wrongly written as Shobina Jameel Mir instead of correct Shabina
Jameel Mir in Aadhaar card. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4548 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Sunny Sharma S/o Ashok Kumar R/o Seiya, Tehsil Sundar Bani,
District Rajouri applying for correction of my name and DoB which are
wrongly written as Sunney Kumar & DoB 19-07-2008 instead of correct
Sunny Sharma & DoB 28-05-2009 in Aadhaar Card bearing No. 8695-
1002-8775. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Yudhvir Singh S/o Krishan Lal R/o Balihote Tehsil & District
Ramban applying for correction of my name and my father name which
are wrongly written as Youdhveer Singh S/o Krishan Singh instead of
correct name Yudhvir Singh S/o Krishan Lal in Aadhaar Card bearing No.
9786-5776-0154. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4549
NOTIFICATION
I, Yash Paul S/o Prem Chand R/o Salyote, Tehsil Chowkichoura,
District Jammu applying for correction of my name which is wrongly
written as Yashpal instead of correct Yash Paul in Aadhaar Card bearing
No. 4963-5115-1294. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Nilam Kumari W/o Bodh Raj R/o Chak Qadre, Bishnah, District
Jammu applying for correction of my name which is wrongly written as
Neelam Kumari instead of correct Nilam Kumari in Aadhaar Card bearing
No. 3720-6618-1830. Now, I am applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4550 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Shakeela Begum W/o Maneer Ahmed R/o Village Tanta, Tehsil
Kahara, District Doda applying for correction of my name which is
wrongly written as Shakila Begum instead of correct name Shakeela
Begum in Aadhaar Card bearing No. 8085-0919-9201. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Zahoor Din S/o Abdul Rashid Malik R/o Village Dhariyari, Tehsil
Bhalessa (Gandoh), District Doda applying for correction of my daughter's
name which is wrongly written as Alya Zahoor instead of correct Aliya
Zahoor in her Aadhaar Card bearing No. 6072-6508-7752. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4551
NOTIFICATION
I, Mohd Sharief S/o Ghulam Hussain R/o Village Banna Tuli, Tehsil
Chassana, District Reasi applying for correction of my daughter's name
which is wrongly written as Tobia Akhter instead of correct Tauiba Akhter
in Aadhaar Card bearing No. 4784 1896 9996. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
This is inform to general public, that my name & my address has been
wrongly mentioned in my Aadhaar Card as Shameema W/o Abdul Subhan
Ganie R/o Faiz Abad Colony Naikhbagh, Srinager instead of Shahmali
w/o Abdul Subhan Ganie R/o Sogam. Now, it needs corrections.
Shahmali
R/o Sogam, Tehsil Sogam, District Kupwara.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4552 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
It is for the information of general public that my name has been
wrongly mentioned as Ruqia Habib C/o Habib U Llah Bhat R/o Naidoori,
Nowshera, Srinagar, instead of Ruqaya Habib C/o Habib U Llah Bhat R/o
Naidoori, Nowshera, Srinagar in my Aadhaar Card under No. 3099 1332
3792. Now, the same needs to be rectified.
Ruqaya Habib C/o Habib U Llah Bhat
R/o Naidoori, Nowshera, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I have changed my name from (old name) Ashiq Ahmad Ganie
S/o Abdul Majeed Ganie to (new name) Ashiq Ahmad Ganayi S/o Ab
Majid Ganayi. In future, I will be known as (new name) Ashiq Ahmad
Ganayi S/o Ab Majid Ganayi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4553
NOTIFICATION
I, Sayed Wassim Ahmed Bihaqi S/o Sayed Irshad Ahmed Bihaqi
R/o House No. 17, Behind Police Headquarters, Noorani Colony,
Peerbagh, Srinagar, intend to correct my name in my DGCA Aircraft
Maintenance Engineer Ligence No. 9701 from Syed Waseem Ahmed
Bihaqi to Sayed Wassim Ahmed Bihaqi as per my Aadhaar Card, PAN
Card and Passport. Now, I am applying for its correction.
Sayed Wassim Ahmed Bihaqi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
It is hereby notified for the information of the general public that due
to an inadvertent error in the Aadhaar Card bearing No. 6937 9004 7274,
the name my ward is incorrectly recorded. The incorrect details are
Fawaad Firdous Bhat (incorrect) instead of correct name Muhammad
Saalim. Now, I am applying for the correction of the same.
Firdous Ahmad Bhat F/o Muhammad Saalim
R/o Batapora Near Jamia Masjid Bugam Batapora, Sub district Chadura,
District Budgam.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4554 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I intend to correct my name and DoB in my Aadhaar Card bearing No.
7709 0273 5721 from Rimsha Tajamul, DoB 03-03-2003, to Veeva
Tajamul, DoB 07-03-2005, as per my Date of Birth Certificate. Now, I
want the correction of the same
Veeva Tajamul D/o Tajamul Hussain
R/o Lasjan, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sharief Din S/o Roshan Din R/o Arbais, Tehsil Mahore, District
Reasi. In Aadhaar Card of my child in which his name was wrongly
written as Mudasar Hussain S/o Sharif Din instead of Mudassir Hussain
S/o Sharief Din. Now, I am applying for correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4555
NOTIFICATION
It is notified for the information of the General Public that my ward's
bame & DoB in Aadhaar Card has been wrongly entered as Zohan Ul Haq
S/o Massarat Adil & DoB is 12-02-2019 while my ward's correct Name &
DoB as per Birth Certificate is Mohd Shazim Bakshi S/o Sajad Ahmad
Bakshi & DoB is 12-02-2021. Now, I want the same to be corrected.
Sajad Ahmad Bakshi F/o Mohd Shazim Bakshi
R/o Gopalpora Kalan, Mattan, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Sharief Din S/o Roshan Din R/o Village Arbais, Tehsil Mahore,
District Reasi, hereby declare that my correct name is Sharief Din. In my
Aadhaar Card, my name has been wrongly mentioned as Sharif Deen.
Now, I am applying for correction of my name in the Aadhaar records.
Sharief Din.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4556 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Sukhwant Kour W/o Rabinder Singh R/o Kothi Shaikh Bansultan,
Jammu applying for correction of my father name which is wrongly
written as Waryam Singh instead of correct Krishan Lal in PAN Card
bearing No. IILPK8572E. Now, it needs correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Rattano Devi W/o Nasib Singh R/o Pallanwala, PO Pallanwala,
Tehsil Khour, District Jammu have applied for the correction of my name
which has been wrongly written as Ratno Devi instead of correct name
Rattano Devi in my Aadhaar Card bearing No. 6052 5482 7656. Now, I
want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4557
NOTIFICATION
It is notified for the information ofthe General Public that I, Asmat
Jan, have voluntarily changed my name to Mir Asma Hassan through an
Affidavit before the Judicial Magistrate 1st Class, Anantnag. Henceforth,
I shall be known and recognised as Mir Asma Hassan. However, my
educational records may continue in the name Asmat Jan. Both names
belong to one and the same person and may be treated accordingly. All
Government, Non-Government, Private, Banking and other official
records, including my Aadhaar Card, shall bear the name Mir Asma
Hassan henceforth.
Mir Asma Hassan D/o Gh Hassan Mir
R/o Mir Mohallah, Sahibabad, Achabal, Anantnag.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Koshalya Devi W/o Lt. Krishan Lal R/o Ward No. 11, House No.
66, Salam Kani Kishtwar Tehsil & District Kishtwar applying for
correction of my name which is wrongly mentioned as Koushila Devi
instead of correct name is Koshalya Devi in my Aadhaar Card bearing No.
8304 4124 0963. Now, I want its correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4558 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Simon Staffi Kandayaray S/o Late Shashi Masih R/o Ward No. 5,
H.No. 180, Christain Colony, R.S. Pura, Jammu state that my name and
my father's name has wrongly been wiritten as Simon Steffi Kandayaray
S/o Shashi instead of Simon Staffi Kandayaray S/o Late Shashi Masih in
my service record in Housing & Urban Local Bodies Department. Now, I
am applying for correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Avishake Singh Jamwal S/o Sh Balwan Singh Jamwal R/o H.No.
13-B, Old Gurha Bakshi Nagar, Jammu, J&K UT-180001 declare that my
name & DoB has been wrongly written as Abhishek Jamwal and
16-02-1987 in my Aadhaar Card bearing No. 7841-2366-1753 instead of
my correct name and DoB is Avishake Singh Jamwal and 16-02-1985 as
per Passport. Now, I am applying for correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4559
NOTIFICATION
I, Kounsar Amin W/o Showkat Ahmad Zarger R/o Sector-8, Lane-4,
Iqbal Abad, Bemina, Srinagar, J&K, state that my name and DoB have
been incorrectly recorded in my Aadhaar Card No. 4988 1872 1593 as
Kousar Showkat DoB 04-03-1972. My correct particulars, as per my
Matriculation Certificate and other supporting documents, are correct
name Kounsar Amin correct DoB 07-02-1972. Now, I want its correction.
Kounsar Amin W/o Showkat Ahmad Zarger
R/o Sector-8 Lane-4, Iqbal Abad, Bemina, Srinagar, J&K.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I hereby apply for correction of my Aadhaar Card bearing Nо. 2289
5703 0879 from Ghlum Mohammad Bhat to Gh Mohd Bhat, father’s name
Sanaullah Bhat to Sonaullah Bhat. Now, it needs correction.
Gh Mohd bhat S/o Sonaullah Bhat
R/o Krumhoora Handwara, Kupwara, Jammu and Kashmir-193221.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4560 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
In my Service Book my name has been mentioned as Farooq Ahamad
Shah and father's name as Kh. Abdul Majed Shah. While as my correct
name is Farooq Ahmad and father's correct name is Kh. Abdul Majeed
Shah. Now, I want to apply for the correction of the same in my Service
Book.
Farooq Ahmad S/o Kh. Abdul Majeed Shah
R/o Tral-i-bala, District Pulwama, Pin-192123, Ph. 9906463500.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I have changed my name from (old name) Abdul Qayoom Sofi to (new
name) Ab Qayoom Sofi. In future, I will be known as (new name) Ab
Qayoom Sofi.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4561
NOTIFICATION
I want to correct my name/parentage in my Aadhaar bearing No. 6767
6017 5262 from Surayya D/o Ghulam Mohammad Mattoo to Suriya Jan
D/o Ghulam Mohmad Mattoo as per my documents. Now, correction is
needed.
Suriya Jan D/o Ghulam Mohmad mattoo
R/o Bagiyas Chattabal, Srinagar.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Bhushan Lal S/o Sh Joginder Paul R/o Village Dager, Tehsil
Akhnoor, now Kharah Balli, District Jammu, J&K UT, Pin Code-185154,
do hereby declare that I have changed my name from Bhushan Lal to
Rahul Sharma. Now, I Shall be known/Identified by name Rahul Sharma
for all, Purposes, Including Educational records, Aadhaar Card bearing
No. 8600 1108 4461, PAN Card, Passport, Voter ID, Driving Licence,
Bank Records and all other Government and Private Documents.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4562 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I, Sanjay Bhat S/o Piyara Lal Bhat R/o Adarsh Colony, Pant Road,
Subashnagar, Clementtown, Dehradun, Uttarakhand-248002 R/o at
present State Bank Colony Talab Tillo, Jammu, UT of J&K, India
applying for correction of my name which is wrongly written as Sanjay
Bhatt S/o Pyare Lal Bhatt instead of correct name Sanjay Bhat S/o Piyara
Lal Bhat in Aadhaar Card bearing No. 7826 0502 0235. Now, I am
applying for the correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Mrs Agiya Suden W/o Ajaib Singh R/o New Bhanteen, Railway
Patri, Makhanpur Gujjran, PO Miran Sahib, Tehsil R.S. Pura, District
Jammu, state that my name has been wrongly written in Aadhaar Card
bearing No. 6471 5420 1796 as Agya Kour instead of Agiya Suden.
Henceforth, I shall be known and called by the name Agiya Suden for all
purposes. This change has been made to maintain uniformity with my
husband’s service records and other official documents.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
No. 18] The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. 4563
NOTIFICATION
I, Sham Kumar F/o Akshara Mahajan R/o Garhi, Tehsil & District
Udhampur (JK UT) inform that my daughter namely Akshara Mahajan
studying in 12th class in K. V. No. 1, Udhampur, Admission No. 34711
but in her school records her father name (my name) has been wrongly
entered as Shyam Kumar instead of correct name is Sham Kumar. Now, I
am applying for correction of the same.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
NOTIFICATION
I, Nazeer Ahmed S/o Mohd Hussain here by declare that my name has
been wrongly written as Nazir Ahmed instead of Nazeer Ahmed (correct
name) and date of birth as 29-12-1974 instead of 25-05-1974 (correct date
of birth) in my Aadhaar Card bearing No. 4730 2157 2514. Now, it needs
correction.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
————
4564 The J&K Official Gazette, the 30th July, 2026/8th Srav., 1948. [No. 18
NOTIFICATION
I want to correct my Aadhaar Card name bearing No. 2841 6629 5045
from Mohammad Shaheen Sheikh S/o Mohammad Sultan Sheikh to
Shaheen Ahmad Sheikh S/o Mohammad Sultan Sheikh. Now, I am
applying for the correction.
Shaheen Ahmad Sheikh S/o Mohammad Sultan Sheikh
R/o Mukdam Mohallah Sozeth Gori Pora, Beerwah.
It is certified that I have complied with other legal requirements in this
connection.
Notification
No legal responsibility is accepted for the publication of
Advertisements/Public Notices in this Part of the Official Gazette of UT
of J&K. Persons notifying the Advertisements/Public Notices shall
remain solely responsible for the legal consequences and also for any
misrepresentation etc.
By order.
General Manager,
Government Press, Srinagar.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Jammu, Friday, the 17th April, 2026/27th Chai., 1948. [No. 4-c
PART III
Laws, Regulations and Rules passed thereunder.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—DEPARTMENT OF LAW JUSTICE AND
PARLIAMENTARY AFFAIRS JAMMU/SRINAGAR.
Notification
Jammu, the 17th of April, 2026.
SO. 118.—In exercise of the powers conferred by Section 40 of the
Gram Nyayalayas Act, 2008 (Central Act of 2009), the Lieutenant
Governor, Union Territory of Jammu and Kashmir has been pleased to
make the following rules, namely :—
1. Short title and commencement,—(i) These rules may be called
the "Jammu and Kashmir Gram Nyayalayas (Conditions of Service of
Officers and Staff) Rules, 2026".
2 The J&K Official Gazette, the 17th April, 2026/27th Chai., 1948.
[No. 4-c
(ii) These rules shall come into force from the date of their
publication in the Government Gazette.
2. Definitions.—In these rules, unless the context otherwise
requires,—
(a) "Act" means Gram Nyayalayas Act, 2008.
(b) "Administrator" means the Lieutenant Governor of Union
Territory of Jammu and Kashmir appointed by President
under Article 239 of the Constitution.
(c) "Conciliator" means conciliator appointed under Section 27
of the Act.
(d) "Government" means the Government of Union Territory of
Jammu and Kashmir.
(e) "High Court" means the High Court of Jammu and Kashmir
and Ladakh ;
(f) "Words and expressions" used but not defined in these rules
shall have the same meaning as assigned to them in the Act.
3. Terms and Conditions of service of the Nyayadhikari.—
Subject to the provisions of section 6 of the Act, the posts of
Nyayadhikaris shall be filled by deputation from amongst the category of
Munsiff/Civil Judge (Junior Division) in the Jammu and Kashmir Civil
Service (Judicial).
4. Salaries and Allowances and other terms and conditions of
Officers and other employees of the Gram Nyayalaya.—(i) The
details of the staff as provided by the Government in terms of Section 17
of the Act are as given in the Schedule appended hereto.
(ii) The salary and allowances of the staff as detailed in the
Schedule shall be such as applicable to equivalent posts governed by
Jammu and Kashmir Ministerial Staff of the Subordinate Courts
(Recruitment and Conditions of Service) Rules, 2016.
(iii) The services of the Staff shall be governed by the provisions of
Jammu and Kashmir Ministerial Staff of the Subordinate Courts
(Recruitment and Conditions of Service) Rules, 2016. The High Court of
Jammu and Kashmir and Ladakh shall make amendments to the Rules
accordingly.
No. 4-c]
The J&K Official Gazette, the 17th April, 2026/27th Chai., 1948.
3
5. Terms and conditions for engagement of the Conciliator.—
(i) The terms and conditions of the Conciliator shall be as follows :—
(a) The Conciliator shall be engaged for a period of three years and
shall be eligible for re-engagement on expiry of term;
(b) The Conciliator shall keep the Nyayadhikari informed in
advance of the duration of leave of his absence;
(c) Ordinarily, the Conciliator shall not remain absent on the date
of sitting fixed by the Nyayadhikari unless the leave of absence
is granted by the Nyayadhikari;
(d) The Conciliator shall submit a Memorandum setting out the
facts and the terms on which parties desire to settle the dispute
amicably.
(ii) The Conciliator shall be entitled to such sitting fee for each day
of sitting and the travelling allowance for taking to and fro journey to the
place of sitting as may be prescribed by the Government in consultation
with High Court.
———
4 The J&K Official Gazette, the 17th April, 2026/27th Chai., 1948.
[No. 4-c
SCHEDULE
S.
No.
Name of the
Post
Pay Level
No.
of
Posts for
one Gram
Nyayalaya
No.
of
Posts
for
22
Gram
Nyayalayas
Pre- Revised (Pay
Band + GP)
Revised
1.
Nazir (HA)
9300-34800 +4200 Level-6
(35400-
112400)
01
22
2.
Steno Typist
5200-20200 +2400 Level-4
(25500-81100)
01
22
3.
Civil/Criminal
Clerk
5200-20200 +1900 Level-2
(19900-63200)
01
22
4.
Orderly
4440-7440 +1300
SL-1 (14800-
47100)
01
22
** These posts have been created vide Government Order No. 3589-
LD (A) of 2014 Dated 14-10-2014.
By Order of Lieutenant Governor.
Sd/-
ACHAL SETHI,
Commissioner Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Jammu, Friday, the 24th April, 2026/4th Vaisa., 1948. [No. 5-a
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— GENERAL ADMINISTRATION
DEPARTMENT, J&K.
Notification
Jammu, the 24th of April, 2026.
S.O. 122.—In exercise of the powers conferred by Section 36A of
the Jammu and Kashmir Panchayati Raj Act, 1989 read with notification
S.O. 42 of 2026, dated 17th of February, 2026, the Lieutenant Governor
of Union Territory of Jammu and Kashmir is pleased to notify
the following terms and conditions of service of Shri Shantmanu,
IAS (Retd.), as State Election Commissioner for the Union Territory of
Jammu and Kashmir ; namely :—
1
Salary
Last pay drawn at the time of his retirement
from the earlier service less by the amount
of the pension, including commuted value
thereof, plus D.A as applicable.
2
The J&K Official Gazette, the 24th April, 2026/4th Vaisa., 1948.
[No. 5-a
2
Tenure of
appointment
He shall hold office for a period of five (05)
years from the date on which he enters his
office or till he attains the age of seventy
years, whichever is earlier :
Provided
that
the
State
Election
Commissioner, may at any time, by writing
under his hand, addressed to the Lieutenant
Governor resign from his office or he may
be removed in the manner provided In
section 36B of the J&K Panchayati Raj Act,
1989.
3
Travelling
Allowance
As was admissible to him at the time of his
retirement from the previous service.
4
Residential
Accommodation
As was admissible to him at the time of his
retirement from the previous service.
5
Medical Facilities
As was admissible to him at the time of his
retirement from the previous service.
6
Leave
As was admissible to him at the time of his
retirement from the previous service.
The power to grant or refuse leave to the
State Election Commissioner and to revoke
or curtail leave granted to him shall vest in
the Lieutenant Governor.
7
Telephone
Charges
As was admissible to him at the time of his
retirement from the previous service.
By order of the Lieutenant Governor.
Sd/-
M. RAJU, IAS,
Commissioner/Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Jammu, Mon., the 27th April, 2026/7th Vaisa., 1948. [No. 5-b
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—DEPARTMENT OF LAW JUSTICE AND
PARLIAMENTARY AFFAIRS SRINAGAR/JAMMU.
(Power Section)
Notification
Jammu, the 27th of April, 2026.
S.O. 123.–In exercise of the powers conferred under sub-section (1)
of section14 of the Bharatiya Nagarik Suraksha Sanhita, 2023, the
Government hereby appoints Lt. Col. Amit Sharma to be the Executive
Magistrate, who shall exercise all the powers of an Executive Magistrate
within the limits of Jammu Cantonment.
By Order of the Government of Jammu and Kashmir.
Sd/-
ACHAL SETHI,
Commissioner/Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Jammu, Wed., the 29th April, 2026/9th Vaisa., 1948. [No. 5-d
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—TRANSPORT DEPARTMENT, J&K.
Notification
Jammu, the 29th of April, 2026.
S.O. 126.—In exercise of powers conferred by sub-section (1) of
section 67 of the Motor Vehicles Act, 1988 (Central Act No. 59 of 1988),
and in partial modification of notification SRO-97 dated 19th
March, 2021, the Government of Jammu and Kashmir hereby directs the
Transport Commissioner, J&K to fix the maximum chargeable fare in
respect of following types of commercial passenger vehicles as per the
percentage of fare hike (over and above the rates as notified vide
2
The J&K Official Gazette, the 29th April, 2026/9th Vaisa., 1948.
[No. 5-d
notification SRO-97 dated 19th March, 2021) shown against each
category :—
S.
No.
Type of Vehicle
Fare Hike %
I
Big Buses (Stage Carriages)
18%
II
Medium/Mini Buses (Stage Carriages)
18%
III
Taxi/Maxi Cab (Base Model Contract Carriages
like; Sumo, Bolero, Tata Indica, Swift, Tata
Winger, Tempo Traveller etc.)
18%
IV
Taxi/Maxi
Cab
(Medium
segment
tourist
Taxi/Maxi Cab contract carriages like, Tavera,
Scorpio, Quails, Xylo etc).
18%
V
Taxi/Maxi
Cab
(Premium
Class
Tourist
Taxi/Maxi cab contract carriages like, Innova,
Fortuner etc).
18%
VI
Auto Rickshaw (Petrol Version)
18%
VII Stage Carriages viz. Tata Magic (Auto)
18%
Provided that, the fare in respect of E-rickshaws and E-autos in the
Union Territory of Jammu and Kashmir shall be fixed as under :
• E-rickshaws : ₹15/- per kilometre.
• E-autos : ₹25/- for the first kilometre and ₹20/- for each
subsequent kilometre.
By order of the Government of Jammu and Kashmir.
Sd/-
DR. PIYUSH SINGLA, IAS,
Secretary to the Government,
Transport Department.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Mon., the 4th May, 2026/14th Vaisa., 1948. [No. 6-c
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—HOME DEPARTMENT, J&K.
Notification
Srinagar, the 4th of May, 2026.
S.O. 132.—Whereas, on 07.08.2025, the Police Station, Vilgam,
received a reliable information to the effect that a suspect identified as
Umer Mohi-ud-din S/o Ghulam Mohi-ud-din Malik R/o Punzwa,
Vilgam, is sharing objectionable contents with the general public through
social media platform with the intention to create terror among the
general public and to disrupt the peace in the area, which poses threat to
sovereignty and integrity of India ; and
2. Whereas, on receipt of information, a FIR No. 50/2025 U/S 152
BNS, came to be registered in the Police Station, Vilgam, and the
investigation, of the case was set into motion ; and
2
The J&K Official Gazette, the 4th May, 2026/14th Vaisa., 1948.
[No. 6-c
3. Whereas, during the investigation, the accused viz. Umer Mohi-
ud-din, was arrested in the case, and during the investigation, some
incriminatory material shared by the accused on the social media
platform was seized/retrieved from his mobile phone; and
4. Whereas, during the course of investigation, the statements of
witnesses acquainted with the facts and circumstances of the case were
recorded; and
5. Whereas, the investigation, conducted by the investigating agency
has prime facie established that the accused viz. Umer Mohi-ud-din, was
using the Facebook Account user ID "UmEr Malik" and knowingly
uploaded objectionable contents and photographs of some killed
terrorists on his Facebook Account, thereby endangering the sovereignty
and territorial integrity of India; and
6. Whereas, on the basis of investigation, statement of witnesses
recorded and other evidence collected, the Investigating Officer has
established prima facie involvement of below mentioned accused for the
commission of offences punishable under section as shown against his
name of the Bharatiya Nyaya Sanhita (BNS), 2023 :—
S.
No.
Name of the accused
Offence
Umer
Mohi
ud
din
S/o
Ghulam
Mohi-ud-din Malik R/o Punzwa, Vilgam.
152
BNS
7. Whereas, the Government has independently examined the Case
Diary file and all the other relevant documents relating to the case and
has come to the conclusion that prima facie case is made out against the
above accused under the aforementioned provisions of BNS;
Now, therefore, in terms of Section 217 of the Bharatiya Nyaya
Suraksha Sanhita, 2023, the Government accord sanction for launching
prosecution against the accused viz. Umer Mohi-ud-din, for the
commission of offence punishable under Section 152 Bharatiya Nyaya
Sanhita, 2023, arising out of FIR No. 50/2025 of Police Station, Vilgam.
By order of the Lieutenant Governor, J&K.
Sd/-
CHANDRAKER BHARTI, IAS,
Principal Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Thu., the 7th May, 2026/17th Vaisa., 1948. [No. 6-d
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— HOUSING AND URBAN DEVELOPMENT
DEPARTMENT, JAMMU/SRINAGAR
Notification
Srinagar, the 7th of May, 2026.
SO. 133.—Whereas, Section 427 of the Jammu and Kashmir
Municipal Corporation Act, 2000, provides as under :—
"427. Power to remove difficulties.—If any difficulty arises in
giving effect to the provisions of this Act or by reasons of anything
contained in this Act to any other enactment for the time being in
force, the Government may, as occasion requires, by order direct
that this Act shall during such period as many be specified in the
order but not extending beyond the expiry of two years from the
commencement orders have effect subject to such adaptations
2
The J&K Official Gazette, the 7th May, 2026/17th Vaisa., 1948.
[No. 6-d
whether by way of modification addition or omission as it may
deem to be necessary and expedient.”
Whereas, Section 395 read with 397 of the Jammu and Kashmir
Municipal Corporation Act, 2000 provides for powers of the Corporation
to make Bye laws, subject to the approval of the Government. These
provisions provide as under :
“395. Powers to make bye-laws.—Subject to the provisions of this
Act and the rules made there under, the Corporation may in addition
to any bye-laws which it is empowered to make under any other
provision of this Act make bye-laws to provide for all or any of the
following matters, namely :—
A. Bye-laws relating to water supply.
B. Bye-laws relating to drainage and sewerage.
C. Bye-laws relating to streets.
D. Bye-laws relating to building.
E. Bye-laws relating to sanitation and public health.
F. Bye-laws relating to public safety and suppression of
nuisances.
G. Bye-laws relating to markets, slaughter houses, trades and
occupations.
H. Bye-laws relating to improvement.
I.
Bye-laws relating to miscellaneous matters.
“397. Supplemental provisions respecting bye-laws.—(1) Any
power to make bye-laws conferred by this Act is conferred subject to
the conditions of the bye-laws being made after previous publication
and their not taking effect until they have been approved by the
Government and published in the Government Gazette.
(2) The Government in approving a bye-law may make any
change therein which appears to it to be necessary.
(3) The Government may, after previous publication of its
intention, cancel any bye-laws which it has approved and thereupon
the bye law shall cease to have effect.
No. 6-d]
The J&K Official Gazette, the 7th May, 2026/17th Vaisa., 1948.
3
Whereas, the Municipal Corporations, Srinagar/Jammu with the
approval of the Government have already notified the Jammu and
Kashmir Unified Building Bye laws, 2021. There is an urgency to amend
said bye laws to make them more people friendly and to ensure that these
bye laws serve the purpose for which these have been notified. The term
of Municipal Corporations, Srinagar/Jammu stands expired and as on
today there no authority to exercise powers of these corporations. As
such, in absence of elected Municipal Corporations a difficulty has arisen
for taking appropriate necessary steps for amending the said bye-laws.
Now Therefore, in exercise of the powers conferred under
Section 427 of the Jammu and Kashmir Municipal Corporation Act,
2000, the Government hereby makes the following order ; namely :—
1. Short title and commencement.—(1) This order may be
called the Jammu and Kashmir Municipal Corporation (Removal of
Difficulties) Order, 2026.
(2) It shall come into force immediately and shall remain in
force for a period of two years or till it is revoked by the
Government, whichever is earlier.
2. Removal of Difficulties.—The difficulties arisen on account of
expiry of the term of Municipal Corporations i.e. Srinagar Municipal
Corporation and Jammu Municipal Corporation and in giving effect to
section 395 and section 397 of the Jammu and Kashmir Municipal
Corporation Act, 2000 are hereby removed by authorizing the
Government to amend the Jammu and Kashmir Unified Building
Bye-laws, 2021 issued in terms of section 395 or section 397 of the ibid
Act from the time, the term of Municipal Corporations has expired and
any amendment made or any action taken by the Government after the
expiry of the term of the aforesaid Corporations shall be deemed to have
been issued by the Corporations itself. This power is to be exercised
subject to ratification by the Municipal Corporations subsequently.
By order of the Government of Jammu and Kashmir.
Sd/-
Mandeep Kaur, IAS,
Commissioner/Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Fri., the 8th May, 2026/18th Vaisa., 1948. [No. 7-a
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— SOCIAL WELFARE DEPARTMENT,
J&K.
Notification
Srinagar, the 8th of May, 2026.
S.O. 136.—In exercise of powers conferred under Rule 87 (1) of the
Jammu & Kashmir Juvenile Justice (Care and Protection of Children)
Rules, 2021, the Government hereby constitutes the Selection-cum-
oversight Committee, with the following composition :—
S.
No.
Name
Status
1.
Justice Puneet Gupta, Former Judge,
High Court of Jammu and Kashmir and
Ladakh.
Chairperson
2
The J&K Official Gazette, the 8th May, 2026/18th Vaisa., 1948.
[No. 7-a
2.
Mission Director, Mission Vatsalya,
J&K
Ex-officio
Member
Secretary
3.
Dr. Shabnam Ara,
Associate Professor, Sociology, Amar
Singh College, Srinagar.
Member
4.
Professor Manisha Kohli,
Principal Government Degree College,
Kunjwani, Jammu.
Member
5.
Ms. Simran Kour,
Peace Educator and Social Activist
Member
6.
A representative of the UT Commission
for Protection of Child Rights (as and
when constituted)
Member
Terms :
1. The tenure of the Committee shall be three years.
2. The quorum for the meeting of the Selection Committee shall not
be less than four Members, including the Chairperson and the
Member Secretary.
3. The Committee shall perform such functions and in such manner
as may be prescribed in the rules.
By order of the Hon’ble Lieutenant Governor.
Sd/-
SARMAD HAFEEZ, IAS,
Commissioner/Secretary to the Government,
Social Welfare Department.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Wed., the 13th May, 2026/23rd Vaisa., 1948. [No. 7-b
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— DEPARTMENT OF LAW, JUSTICE AND
PARLIAMENTARY AFFAIRS, SRINAGAR/JAMMU.
(Power Section)
Notification
Srinagar, the 13th of May, 2026.
S.O. 138.—In exercise of the powers conferred under sub-section
(1) of Section 14 of the Bharatiya Nagarik Suraksha Sanhita, 2023, the
Government hereby appoints below mentioned Officers to be the
Executive Magistrate, who shall exercise all the powers of an Executive
Magistrate within their territorial jurisdiction of District Jammu.
S. No.
Name
Designation
Jurisdiction
1
Ms. Indu Sakshi
Tehsildar
Migrant Camps,
Jammu.
2
Ms. Namrita Bhan
Tehsildar
2 The J&K Official Gazette, the 13th May, 2026/23rd Vaisa., 1948.
[No. 7-b
3
Sh.
Shehzad
Latief
Khan
Tehsildar
4
Ms. Bharti
AE
By order of the Government of Jammu and Kashmir.
Sd/-
ACHAL SETHI,
Commissioner/Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Wed., the 13th May, 2026/23rd Vaisa., 1948. [No. 7-c
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— DEPARTMENT OF LAW, JUSTICE AND
PARLIAMENTARY AFFAIRS, SRINAGAR/JAMMU.
Notification
Srinagar, the 13th of May, 2026.
S.O. 139.—In exercise of powers conferred by section 3 of the
Prevention of Corruption Act, 1988 (Central Act) and in partial
modification of notification S.O. 297 of 2025 dated 20-11-2025, the
Government hereby appoints the following Judicial Officers as Special
Judges, Anti-Corruption for trial of offences specified in section 4 of
2 The J&K Official Gazette, the 13th May, 2026/23rd Vaisa., 1948.
[No. 7-c
the said Act within their respective territorial jurisdiction shown against
each :—
S.
No.
Name of the Judicial
Officer
S/Shri
Place of Posting/Jurisdiction
1
Mir Wajahat
Additional District and Sessions
Judge,
Bandipora
(Designated
Special Court under the Prevention
of Corruption Act).
2
Tasleem Arief, Special
Judge Anti Corruption,
Srinagar.
Additional District and Sessions
Judge, Anti Corruption, Srinagar.
By order of the Government of Jammu and Kashmir.
Sd/-
ACHAL SETHI,
Commissioner/Secretary to the Government.
EXTRAORDINARY
REGD NO. JK—33
THE
JAMMU AND KASHMIR OFFICIAL GAZETTE
————————————————————————————————————
Vol. 139] Srinagar, Wed., the 20th May, 2026/30th Vai., 1948.
[No. 8-d
————————————————————————————————————
Separate paging is given to this part in order that it may be filed
as a separate compilation.
————————————————————————————————————
PART I—B
Jammu and Kashmir Government—Notifications.
————
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—HOME DEPARTMENT, SRINAGAR/ JAMMU.
Notification
Srinagar, 20th of May, 2026.
SO-144.—In exercise of the powers conferred under Section 2 (1) (u) of the
Bharatiya Nagarik Suraksha Sanhita, 2023, read with Notification in
S.O No. 2506(E) dated 28.06.2024 of the Ministry of Home Affairs, New Delhi
and in partial modification of earlier Notification issued on the subject, the
Government hereby exclude village Odina from the jurisdiction of Police Station
Pattan, District Baramulla and declare the Police Post Nowgam, P/S Sumbal of
District Police Bandipora as Police Station for the area of village Odina, for the
purpose of registration and investigation of all the offences.
By order of the Lieutenant Governor of Jammu and Kashmir.
Sd/-
CHANDRAKER BHARTI, IAS,
Principal Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Thu., the 21st May, 2026/31st Vaisa., 1948. [No. 8-a
PART III
Laws, Regulations and Rules passed thereunder.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—TRANSPORT DEPARTMENT, J&K.
Notification
Srinagar, the 21st May, 2026.
S.O. 145.—In exercise of the powers conferred by the proviso to
Article 309 of the Constitution of India, sanction is hereby accorded to
carrying out the following amendments in the Jammu and Kashmir
Motor
Vehicles
Department
(Subordinate)
Service
Recruitment
Rules, 2020 :
(i) In Schedule-I and Schedule-II (Ministerial Cadre), for the
words, "Orderly" and "Chowkidar" wherever appearing, the
2
The J&K Official Gazette, the 21st May, 2026/31st Vaisa., 1948.
[No. 8-a
words "Multitasking Staff (MTS)" shall be substituted
respectively ;
(ii) In Schedule-I and Schedule-II (Ministerial Cadre), for the
words, "Traffic Orderly" wherever appearing, the words
"Traffic MTS" shall be substituted.
By order of the Lieutenant Governor.
Sd/-
AVNY LAVASA, IAS,
Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Thu., the 21st May, 2026/31st Vaisa., 1948. [No. 8-b
PART III
Laws, Regulations and Rules passed thereunder.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— HEALTH AND MEDICAL EDUCATION
DEPARTMENT, J&K.
Notification
Srinagar, the 21st May, 2026.
S.O. 146.—In exercise of the powers conferred by Section 2 of the
Epidemic Diseases Act, 1897, and in the interest of public health
surveillance, epidemiological assessment, treatment planning and
formulation of evidence- based health policy, the Lieutenant Governor of
Jammu and Kashmir hereby declares "Cancer" as a "Notifiable Disease"
throughout the Union Territory of Jammu and Kashmir.
Accordingly, it is hereby ordered that :
1. Applicability.—The provisions of this notification shall
apply to the following institutions/entities within the Union
Territory of Jammu and Kashmir :—
a. All Government, autonomous, private, cooperative and
institutional
hospitals,
including
Medical
College
2
The J&K Official Gazette, the 21st May, 2026/31st Vaisa., 1948.
[No. 8-b
Hospitals, ESI Hospitals, AIIMS, Railway Hospitals,
Industrial Hospitals, Military Hospitals and any other
hospitals providing healthcare services;
b. Private clinics, nursing homes, hospices and all
establishments providing cancer diagnosis, treatment or
palliative care;
c. AYUSH hospitals/institutions providing cancer-related
treatment/care;
d. Non-Governmental
Organizations
and
Insurance
Companies (Government/Private), wherever maintaining
treatment/claims data pertaining to cancer patients ;
relevant
e. All pathology, histopathology, cytology, molecular
diagnostic and radiology/imaging laboratories/centres
diagnosing or reporting cancer cases;
f. Registrar
of
Births
and
Deaths/Vital
Statistics
Authorities for furnishing cause-specific mortality data
relating to cancer;
g. Any
Government
or
private
scheme/programme/
institution collecting or maintaining cancer-related health
data.
2.
Mandatory
Reporting.—Every
institution/entity
covered under Para 1 shall mandatorily report all diagnosed
and/or treated cancer cases in the prescribed format through the
notified reporting mechanism.
3.
Maintenance
of
Register.—Each
reporting
institution/entity shall maintain a dedicated Cancer Register in
the prescribed proforma for recording all existing and newly
diagnosed cancer cases from the date of issuance of this
notification.
4. Role of Chief Medical Officers.—The concerned Chief
Medical Officer shall ensure compliance of this notification by
all reporting institutions/entities within his/her jurisdiction and
monitor timely and accurate submission of cancer-related data.
5. Online Reporting Portal.—
a. A dedicated online portal shall be prepared by the
Health and Medical Education for reporting of the
cases.
No. 8-b]
The J&K Official Gazette, 21st May, 2026/31st Vaisa., 1948.
3
b. All hospitals empanelled under PMJAY-SEHAT
Health Scheme shall be auto- registered on the notified
Union Territory online portal and provided login
credentials for submission of cancer case data;
c. All other reporting institutions/entities shall register on
the notified portal for obtaining login credentials and
submitting requisite cancer case details.
6. Validation and Scrutiny of Data.—
a. The State Cancer Institute, Government Medical
College, Jammu and Sher- i-Kashmir Institute of
Medical Sciences, Soura shall function as Centres of
Excellence for scrutiny, validation and verification of
cancer case data submitted under this notification ;
b. These institutions may requisition additional case-
specific information from reporting entities, under
intimation to the concerned Chief Medical Officer,
wherever required for validation purposes;
c. The Director, Sher-i-Kashmir Institute of Medical
Sciences, Soura shall be the overall Nodal Officer and
shall ensure regular transmission of validated data to
the National Cancer Registry Programme maintained
by the Indian Council of Medical Research (ICMR).
7. Confidentiality of Data.—All information collected
under this notification shall be treated as strictly confidential and
shall
be
used
solely
for
public
health
surveillance,
epidemiological research, treatment planning, policy formulation
and allied governmental purposes. Personally identifiable
information shall not be disclosed except in accordance with law.
Data shall be securely stored, processed and transmitted.
8.
Implementation.—The
Director,
Sher-i-Kashmir
Institute of Medical Sciences, Soura; Principal, Government
Medical College, Jammu; Director Health Services, Jammu; and
Director Health Services, Kashmir shall take necessary steps for
effective implementation of this notification.
By order of the Lieutenant Governor.
Sd/-
M. RAJU, IAS,
Commissioner/Secretary to the Government,
Health & Medical Education Department.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Mon., the 1st June, 2026/11th Jyai., 1948.
[No. 10-a
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— DEPARTMENT OF LAW, JUSTICE AND
PARLIAMENTARY AFFAIRS, SRINAGAR/JAMMU.
(Power Section)
Notification
Srinagar, the 1st June, 2026.
S.O.
150.—In
exercise
of
the
powers
conferred
under
sub-section (1) of section 14 of the Bharatiya Nagarik Suraksha
Sanhita, 2023, the Government hereby appoints Sh. Raj Kumar,
Naib Tehsildar Niabat Keerian Gandyal, Tehsil Kathua to be the
Executive Magistrate, who shall exercise all the powers of an Executive
Magistrate within his territorial jurisdiction of District Kathua.
By order of the Government of Jammu and Kashmir.
Sd/-
ACHAL SETHI,
Commissioner Secretary to the Government.
EXTRAORDINARY REGD NO. JK–33
—————————————————————————————
Vol. 139 Srinagar, Tue., the 2nd June, 2026/12th Jyai., 1948.
[No. 10-b
PART I—B
Jammu and Kashmir Government—Notifications.
———
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT— DEPARTMENT OF LAW, JUSTICE AND
PARLIAMENTARY AFFAIRS, SRINAGAR/JAMMU.
(Power Section)
Notification
Srinagar, the 2nd June, 2026.
S.O.
151.—In
exercise
of
the
powers
conferred
under
sub-section (1) of Section 14 of the Bharatiya Nagarik Suraksha
Sanhita, 2023,the Government hereby appoints the officers as annexed in
Annexure “A” to be the Executive Magistrate(s), who shall exercise all
the powers of an Executive Magistrate within their respective territorial
jurisdictions of District Pulwama in view of SANJY-2026.
By order of the Government of Jammu and Kashmir.
Sd/-
ACHAL SETHI,
Commissioner/Secretary to the Government.
———
2
The J&K Official Gazette, the 2nd June, 2026/12th Jyai., 1948.
[No. 10-b
Annexure 'A' to S.O. 151 of 2026 dated 02-06-2026.
S.
No.
Name of the Officer
Designation
Place of
Posting
1.
Mr. Sartaj id ul Amin
Horticulture Dev. Officer Tral
Horticulture
Department
Pulwama
2.
Mr. Gowhar Ahmad Dar
Horticulture Dev. Officer
Hariparigam
3.
Mr. Mohammad Manzoor
Guroo
Horticulture Dev. Officer
Shadimarg
4.
Mr.
Manzoor
Ahmad
Najar
Horticulture Dev. Officer
Litter
5.
Dr Gulam Jeelani Ganai
Technical Officer to DSHO
Pulwama
Sheep
Husbandry
Department
6.
Mr. Arsheed Hussain Mir
I/C Agriculture Extension
Officer Abhama
Agriculture
Department
Pulwama
7.
Mr. Khursheed Ahmad
Mir
I/c Agriculture Extension
Officer Shadimarg
8.
Mr. Showket Ahmad
Rather
Agriculture Extension Officer
Newa
9.
Mr. Syed Tawseef Ahmad Agriculture Extension Officer
Kakapora
10. Mr. Reyaz Ahmad Parra
I/c Agriculture Extension
Officer Hawl
11. Mr. Feroz Ahmad
I/c Agriculture Extension
Officer Khaigam
12. Mr. Mohammad Yaqoob
Mir
Agriculture Extension Officer
Tral
13. Mr. Mir Ashiq Hussain
I/c Agriculture Extension
Officer Pampore
14. Mr. Ashiq Ahmad Lone
I/c Agriculture Extension
Officer Lurgam
15. Mr. Sawlat Ahmad Bhat
AHTO Crewel ETC Chakoora
16. Mr. Khalid Hussain Bhat
AHTO Chain Stitch ETC
Gulabbagh
17. Mr. Sajad Ahmad Ganaie
AHTO Wood Carving ETC
Looswani
18. Mr. Mohd Ashraf Mir
AHTO Wood Carving ETC
Kakpora
No. 10-b] The J&K Official Gazette, the 2nd June, 2026/12th Jyai., 1948.
3
19. Mr. Parvaiz Ahmad Parray AHTO Namdha ETC Ladhoo Handicrafts
And Handloom
Department
Pulwama.
20. Mr. Shafiq Ahmad Wani
AHTO Spinnning ETC
Padgampora
21. Mr. Mohammad Rafi Butt AHTO Gabba ATC Dusoo
22. Mr. Rayees Ahmad Kutty Sericulture Assistant Pahoo
Sericulture
Department
Pulwama
23. Mr. Imtiyaz Ah. Mir
Assistant Grading and
Marketing Officer
Area Planning
and Marketing
Department
Pulwama
24. Er. Abdul Ghafoor
Junior Engineer Irrigation
Sub-Division Marwal
Irrigation
Construction
Division
Pampore
25. Er. Imran Ahmad
Assistant Engineer Irrigation
Sub-Division Marwal
EXTRAORDINARY
REGD NO. JK—33
THE
JAMMU AND KASHMIR OFFICIAL GAZETTE
————————————————————————————————————
Vol. 139] Srinagar, Wed., the 3rd June, 2026/13th Jyai., 1948. [No. 10-e
————————————————————————————————————
Separate paging is given to this part in order that it may be filed
as a separate compilation.
————————————————————————————————————
PART I—B
Jammu and Kashmir Government—Notifications.
————
GOVERNMENT OF JAMMU AND KASHMIR
CIVIL SECRETARIAT—HOME DEPARTMENT, J&K.
Notification
Srinagar, the 3rd of June, 2026.
SO-152.—In exercise of powers conferred under clause (b) of sub-section (1)
of Section 20 of the Bharatiya Nagarik Suraksha Sanhita, 2023 read with
S.O. No. 2506(E) dated 28.06.2024 of the Ministry of Home Affairs, Government
of India and pursuant to the Government Order issued vide No. 68-Home of 2025
dated 29.01.2025, the Government of Jammu and Kashmir hereby establish the
District Directorate of Prosecution headed by Deputy Director, Prosecution in each
District of the UT of J&K to exercise powers and functions as envisaged under
clauses (8), (9) and (10) of section 20 of Bharatiya Nagarik Suraksha Sanhita, 2023
and such other powers and functions as the Government may assign to it from time
to time, till further orders in this behalf.
By order of the Government of Jammu and Kashmir.
Sd/-
CHANDRAKER BHARTI, IAS,
Principal Secretary to the Government.
MINISTRY OF LAW AND JUSTICE
/HJLVODWLYH'HSDUWPHQW
New Delhi, the 16th April, 2025/Chaitra 26, 1947 (Saka)
The following Act of Parliament received the assent of the President on the
16th April, 2025 and is hereby published for general information:—
THE PROTECTION OF INTERESTS IN AIRCRAFT OBJECTS
ACT, 2025
1ඈඈൿ
[16th April,@
An Act to provide for protection of interests in aircraft objects and to
implement the Convention on International Interests in Mobile
Equipment and the Protocol to the Convention on International Interests
LQ0RELOH(TXLSPHQWRQ0DWWHUV6SHFL¿FWR$LUFUDIW(TXLSPHQWVLJQHG
at Cape Town on 16th November, 2001 and for matters connected
WKHUHZLWKRULQFLGHQWDOWKHUHWR
BE it enacted by Parliament in the Seventy-sixth Year of the Republic
of India as follows:—
1 (1)This Act may be called the Protection of Interests in Aircraft Objects
Act, 2025
(2) It shall come into force on such date as the Central Government may, by
QRWLILFDWLRQLQWKH2IILFLDO*D]HWWHDSSRLQW
2 (1) In this Act, unless the context otherwise requires,—
(a) “agreement” shall have the meaning assigned to it in Article 1(a) of
the Convention;
Short title and
FRPPHQFHPHQW
'HILQLWLRQV
EXTRAORDINARY
REGD NO. JK–33
———————————————————————————————
Vol. 139
Srinagar, Thu., the 11th June, 2026/21st Jyai., 1948. [No. 11-18
———————————————————————————————
PART IV
Reprints from the Government of India Gazette.
———
Application of
Convention and
Protocol in
India.
Power of
registry
authority to
issue directions.
Obligation of
debtor and
creditor to an
agreement.
(E) “aircraft” shall have the meaning assigned to it in Article I ()(D) of
the Protocol;
(F) “aircraft objects” shall have the meaning assigned to it in
Article I ()(F) of the Protocol;
(G) “Article” means an Article of the Convention or the Protocol;
(H) “Convention” means the Convention on International Interests in
Mobile Equipment signed at Cape Town on 16th November, 2001, as set out
in the First Schedule to this Act;
(I) “creditor” shall have the meaning assigned to it in Article 1(L) of the
Convention;
(J) “debtor” shall have the meaning assigned to it in Article 1(M) of the
Convention;
(K) “declaration” means a declaration made by India under the
Convention or the Protocol, as set out in the Second Schedule to this Act;
(L) “declared default” means the date on which the registry authority is
notified by the creditor of the occurrence of default;
(M) “international interest” shall have the meaning assigned to it in
Article 1(R) of the Convention;
(N) “prescribed” means prescribed by rules made under this Act;
(O) “Protocol” means the Protocol to the Convention on International
Interests in Mobile Equipment on Matters specific to Aircraft Equipment
signed at Cape Town on 16th November, 2001, as set out in the Third Schedule
to this Act;
(P) “registry authority” means the Directorate General of Civil Aviation
constituted under section 3 of the Bharatiya Vayuyan Adhiniyam, 2024.
() The words and expressions used and not defined in this Act, but defined in
the Convention or the Protocol or the regulations made thereunder, shall have the
meanings respectively assigned to them in the Convention, Protocol or regulations
made thereunder.
. Subject to the provisions of this Act, the Convention and Protocol shall have
the force of law in India, in respect of the aircraft objects and in accordance with the
declarations deposited by India.
. The registry authority may issue necessary directions, for implementation
of the provisions of the Convention and Protocol, including the provisions given
force of law under section 3, in such manner as may be prescribed.
. () A debtor shall maintain and submit to the registry authority, records of
dues arising from, related to or owed in regard to the ownership or use by the
owner or operator of the aircraft object, in such form and manner as may be
prescribed.
() A creditor shall not be entitled to exercise any remedy under the
Convention or Protocol unless such creditor declares the occurrence of default by
notifying the registry authority, in such form and manner as may be prescribed.
16 of 2024.
2 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
16 of 202
6 7KHSURYLVLRQVRI$UWLFOH;,RIWKH3URWRFROVXEMHFWWRWKHGHFODUDWLRQ
deposited by India, shall apply, mutatis mutandis, for remedies on insolvency
under any law for the time being in force:
Provided that—
(a) the debtor of the agreement is a—
(i) ERG\FRUSRUDWHRU¿UPLQFRUSRUDWHGRUUHJLVWHUHGLQ,QGLD RU
(ii) person, domiciled in or has his principal place of business in
India;
(b) the international interest of the agreement has been registered in
accordance with the Convention and Protocol; and
(c) the debtor and creditor have not by written agreement excluded the
DSSOLFDWLRQRIWKLVVHFWLRQ
7 6XEMHFWWRWKHSURYLVLRQVRIWKHBharatiya Vayuyan Adhiniyam, 2024, or
any rules made thereunder, the provisions of Article XIII of the Protocol shall
apply to the de-registration and export UHTXHVW
8 Notwithstanding anything in any other law for the time being in force,
the High Court having territorial jurisdiction shall be the relevant court for the
SXUSRVHVRI$UWLFOHRIWKH&RQYHQWLRQ
9 (1) In the case of any inconsistency between a provision of this Act and
any other law for the time being in force, the provisions of this Act shall prevail
WRWKHH[WHQWRIVXFKLQFRQVLVWHQF\
(2) Save as otherwise provided in this Act, the provisions of this Act
shall be in addition to, and not in derogation of any other law for the time
EHLQJLQIRUFH
(3) The provisions of this Act or the Convention or the Protocol shall
notaffect the rights of the Central Government or any entity thereof,
or
other
provider
of
public
services
in
India,
or
any
inteUgovernmentDO organisation in which India is
a member, to arrest or
detain an aircraft object under any law for
the
time
being
in
force,
for
payment
of
any amount due to the Government of India or any
such entity or provider of
public
services or organisation,
directly
relating to the service or services provided by it in respect of that aircraft
REMHFWV
10 (1) 7KH &HQWUDO *RYHUQPHQW PD\ E\ QRWL¿FDWLRQ LQ WKH 2൶FLDO
Gazette, make rules, as may be considered necessary and expedient, for carrying
out the provisions of this Act or implementation of the provisions of the
&RQYHQWLRQRU3URWRFRO
,QSDUWLFXODUDQGZLWKRXWSUHMXGLFHWRWKHJHQHUDOLW\RIWKHIRUHJRLQJSRZHU
VXFKUXOHVPD\SURYLGHIRUDOORUDQ\RIWKHIROORZLQJPDWWHUVQDPHO\ ²
D PDQQHUWRLVVXHGLUHFWLRQVXQGHUVHFWLRQ
E IRUPDQGPDQQHUXQGHUVXEVHFWLRQV DQG RIVHFWLRQ
Remedies on
LQVROYHQF\
De-registration
and export
request
DXWKRULVDWLRQ
-XULVGLFWLRQ
Provisions of
Act to have
overriding
HIIHFW
Power of
Central
Government to
PDNHUXOHV
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3
Power of
Central
Government in
respect of
GHFODUDWLRQV
Removal of
GLIILFXOWLHV
(3) The power to make rules under this section is subject to the condition of
the rules being made after previous publication:
Provided that the Central Government may, in the public interest, by order
in writing, dispense with the condition of previous publiFDWLRQLQDQ\FDVH
(4) Every rule made under this Act shall be laid, as soon as may be, after it
is made before each House of Parliament while it is in session, for a total period
of thirty days which may be comprised in one session or in two or more successive
sessions, and if, before the expiry of the session immediately following the session
or the successive sessions aforesaid, both Houses agree in making any
PRGL¿FDWLRQLQWKHUXOHRUERWK+RXVHVDJUHHWKDWWKHUXOHVKRXOGQRWEHPDGHWKH
rule shall WKHUHDIWHUKDYHHIIHFWRQO\LQVXFKPRGL¿HGIRUPRUEHRIQRHIIHFWDV
WKHFDVHPD\EH VRKRZHYHUWKDWDQ\VXFKPRGL¿FDWLRQRUDQQXOPHQWVKDOOEH
ZLWKRXWSUHMXGLFHWRWKHYDOLGLW\RIDQ\WKLQJSUHYLRXVO\GRQHXQGHUWKDWUXOH
11 (1) The Central Government may make, amend or withdraw any
declaration, or any subsequent declaration in accordance with the provisions of
WKH&RQYHQWLRQRU3URWRFRO
(2) The Central Government, to give effect to any declaration or
subsequent declaration made, amended or withdrawn under the Convention or
the Protocol, PD\E\QRWL¿FDWLRQLQWKH2൶FLDO*D]HWWHDPHQGWKHSecond
6FKHGXOHWRWKLV$FW
12 (1) ,IDQ\GL൶FXOW\DULVHVLQJLYLQJHIIHFWWRWKHSURYLVLRQVRIWKLV$FW
the Central Government may, by order published in the 2൶FLDO*D]HWWHPDNH
such provisions, not inconsistent with the provisions of this Act as appear to it to
be necessary or expedient for removing the difficulty:
Provided that no such order shall be made after the expiry of a period of
three years from the GDWHRIFRPPHQFHPHQWRIWKLV$FW
(2) Every order made under this section shall, as soon as may be after it is
PDGHEHODLGEHIRUHHDFK+RXVHRI3DUOLDPHQW
4 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
THE FIRST SCHEDULE
[See clause (e) of sub-section (1) of VHFWLRQ@
PROVISIONS OF THE CONVENTION ON INTERNATIONAL INTER(STS IN MOBILE
EQUIPMENT WHICH SHALL HAVE THE FORCE OF LAW
CHAPTER I
SPHERE OF APPLICATION AND GENERAL PROVISIONS
$UWLFOH
Definitions
In this Convention, except where the context otherwise requires, the
following terms are employed with the meanings set out below:
(a) “agreement” means a security agreement, a title reservation
agreement or a leasing agreement;
(b) “assignment” means a contract which, whether by way of security
or otherwise, confers on the assignee associated rights with or without a
transfer of the related international interest;
(c) “associated rights” means all rights to payment or other
performance by a debtor under an agreement which are secured by or
associated with the object;
(d) “commencement of the insolvency proceedings” means the time at
which the insolvency proceedings are deemed to commence under the
applicable insolvency law;
(e) “conditional buyer” means a buyer under a title reservation
agreement;
(f) “conditional seller” means a seller under a title reservation
agreement;
(g) “contract of sale” means a contract for the sale of an object by a
seller to a buyer which is not an agreement as defined in (a) above;
(h) “court” means a court of law or an administrative or arbitral
tribunal established by a Contracting State;
(i) “creditor” means a chargee under a security agreement, a
conditional seller under a title reservation agreement or a lessor under a
leasing agreement;
(j) “debtor” means a chargor under a security agreement, a conditional
buyer under a title reservation agreement, a lessee under a leasing agreement
or a person whose interest in an object is burdened by a registrable
non-consensual right or interest;
(k) “insolvency administrator” means a person authorised to administer
the re-organisation or liquidation, including one authorised on an interim
basis, and includes a debtor in possession if permitted by the applicable
insolvency law;
(l) “insolvency proceedings” means bankruptcy, liquidation or other
collective judicial or administrative proceedings, including interim
proceedings, in which the assets and affairs of the debtor are subject to
control or supervision by a court for the purposes of re-organisation or
liquidation;
(m) “interested persons” means:
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 5
(i) the debtor;
(ii) any person who, for the purpose of assuring performance of
any of the obligations in favour of the creditor, gives or issues a
suretyship or demand guarantee or a stand by letter of credit or any
other form of credit insurance;
(iii) any other person having rights in or over the object;
(n) “internal transaction” means a transaction of a type listed in
Article 2(2)(a) to (c) where the centre of the main interests of all parties to
such transaction is situated, and the relevant object located (as specified in
the Protocol), the same Contracting State at the time of the conclusion of the
contract and where the interest created by the transaction has been registered
in a national registry in that Contracting State which has made a declaration
under Article 50(1);
(o) “international interest” means an interest held by a creditor to
which article 2 applies;
(p)“international registry” means the international registration facilities
established for the purposes of this Convention or the Protocol;
(q)“leasing agreement” means an agreement by which one person
grants a right to possession or control of an object (with or without an option
to purchase) to another person in return for a rental or other payment;
(r)“national interest” means an interest held by a creditor in an object
and created by an internal transaction covered by a declaration under
Article 50 (1);
(s) “non-consensual right or interest” means a right or interest
conferred under the law of a Contracting State which has made a declaration
XQGHU$UWLFOH WRVHFXUHWKHSHUIRUPDQFHRIDQREOLJDWLRQLQFOXGLQJDQ
obligation to a State, State entity or an intergovernmental or private
organisation;
(t) “notice of a national interest” means notice registered or to be
registered in the international registry that a national interest has been
created;
(u) “object” means an object of a category to which Article 2 applies;
(v) “pre-existing right or interest” means a right or interest of any kind
in or over an object created or arising before the effective date of this
Convention as defined by Article 60(2)(a);
(w) “proceeds” means money or non-money proceeds of an object
arising from the total or partial loss or physical destruction of the object or
its total or partial confiscation, condemnation or requisition;
(x) “prospective assignment” means an assignment that is intended to
be made in the future, upon the occurrence of a stated event, whether or not
the occurrence of the event is certain;
(y) “prospective international interest” means an interest that is
intended to be created or provided for in an object as an international interest
in the future, upon the occurrence of a stated event (which may include the
debtor’s acquisition of an interest in the object), whether or not the
occurrence of the event is certain;
(z) “prospective sale” means a sale which is intended to be made in
the future, upon the occurrence of a stated event, whether or not the
occurrence of the event is certain;
6 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(aa) “Protocol” means, in respect of any category of object and
associated rights to which this Convention applies, the Protocol in respect
of that category of object and associated rights;
(bb) “registered” means registered in the international registry
pursuant to Chapter V;
(cc) “registered interest” means an international interest, a registrable
non-consensual right or interest or a national interest specified in a notice of
a national interest registered pursuant to Chapter V;
(dd) “registrable non-consensual right or interest” means a non-consensual
right or interest registrable pursuant to a declaration deposited under Article 40;
(ee) “Registrar” means, in respect of the Protocol, the person or body
designated by that Protocol or appointed under Article 17(2)(b);
(ff) “regulations” means regulations made or approved by the
supervisory authority pursuant to the Protocol;
(gg) “sale” means a transfer of ownership of an object pursuant to a
contract of sale;
(hh) “secured obligation” means an obligation secured by a security
interest;
(ii) “security agreement” means an agreement by which a chargor
grants or agrees to grant to a chargee an interest (including an ownership
interest) in or over an object to secure the performance of any existing or
future obligation of the chargor or a third person;
(jj) “security interest” means an interest created by a security
agreement;
(kk) “Supervisory Authority” means, in respect of the Protocol, the
Supervisory Authority referred to in Article 17(1);
(ll) “title reservation agreement” means an agreement for the sale of
an object on terms that ownership does not pass until fulfilment of the
condition or conditions stated in the agreement;
(mm) “unregistered interest” means a consensual interest or
non-consensual right or interest (other than an interest to which
$UWLFOH DSSOLHV) which has not been registered, whether or not it is
registrable under this Convention; and
(nn) “writing” means a record of information (including information
communicated by teletransmission) which is intangible or other form and is
capable of being reproduced in tangible form on a subsequent occasion and
which indicates by reasonable means a person’s approval of the record.
$UWLFOH
The international interest
1 7KLV FRQYHQWLRQ SURYLGHV IRU WKH FRQVWLWXWLRQ DQG HIIHFWV RI DQ
international interest in certain categories of mobile equipment and associated
ULJKWV
2)RUWKHSXUSRVHVRIWKLV&RQYHQWLRQDQLQWHUQDWLRQDOLQWHUHVWLQPRELOH
equipment is an interest, constituted under Article 7, in a uniquely identifiable
object of a category of such objects lLVWHGLQSDUDJUDSKDQGGHVLJQDWHGLQWKH
Protocol:
(a) granted by the chargor under a security agreement;
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 7
(b) vested in a person who is the conditional seller under a title
reservation agreement; or
(c) YHVWHGLQDSHUVRQZKRLVWKHOHVVRUXQGHUDOHDVLQJDJUHHPHQW
An interest falling within sub-paragraph (a) does not also fall within
sub-paragraph (b) or (c)
37KHFDWHJRULHVUHIHUUHGWRLQWKHSUHFHGLQJSDUDJUDSKVDUH
(a) airframes, aircraft engines and helicopters;
(b) railway rolling stock; and
(c) VSDFHDVVHWV
47KHDSSOLFDEOHODZGHWHUPLQHVZKHWKHUDQLQWHUHVWWRZKLFKSDUDJUDph 2
applies falls within sub-paragraphs (a), (b) or (c) RIWKDWSDUDJUDSK
5$QLQWHUQDWLRQDOLQWHUHVWLQDQREMHFWH[WHQGVWRSURFHHGVRIWKDWREMHFW
$UWLFOH
Sphere of application
1 7KLV &RQYHQWLRQ DSSOLHV ZKHQ DW WKH WLPH RI WKH FRQFOXVLRQ RI WKH
agreement creating or providing for the international interest, the debtor is situated
LQD&RQWUDFWLQJ6WDWH
27KHIDFWWKDWWKHFUHGLWRULVVLWXDWHGLQDQRQ-Contracting State does not
DIIHFWWKHDSSOLFDELOLW\RIWKLV&RQYHQWLRQ
$UWLFOH
Where debtor is situated
1)RUWKHSXUSRVHVRI$UWLFOH (1), the debtor is situated in any Contracting
State:
(a) under the law of which it is incorporated or formed;
(b) where it has its registered office or statutory seat;
(c) where it has its center of administration; or
(d) ZKHUHLWKDVLWVSODFHRIEXVLQHVV
2$UHIHUHQFHLQVXE-paragraph (d) of the preceding paragraph to the debtor’s
place of business shall, if it has more than one place of business, mean its principal
SODFHRIEXVLQHVVRULILWKDVQRSODFHRIEXVLQHVVLWVKDELWXDOUHVLGHQFH
$UWLFOH
Interpretation and applicable law
1,QWKHLQWHUSUHWDWLRQRIWKLVFRQYHQWLRQUHJDUGLVWREHKDGWRLWVSXUSRVHs
as set forth in the preamble, to its international character and to the need to
SURPRWHXQLIRUPLW\DQGSUHGLFWDELOLW\LQLWVDSSOLFDWLRQ
24XHVWLRQVFRQFHUQLQJPDWWHUVJRYHUQHGE\WKLVFRQYHQWLRQZKLFKDUHQRW
expressly settled in it are to be settled in conformity with the general principles
on which it is based or, in the absence of such principles, in conformity with the
DSSOLFDEOHODZ
35HIHUHQFHVWRWKHDSSOLFDEOHODZDUHWRWKHGRPHVWLFUXOHVRIWKHODZ
applicable by virtue of the rules of privaWHLQWHUQDWLRQDOODZRIWKHIRUXP6WDWH
8 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
4:KHUHD6WDWHFRPSULVHVVHYHUDOWHUULWRULDOXQLWVHDFKRIZKLFKKDVLWV
own rules of law in respect of the matter to be decided, and where there is no
indication of the relevant territorial unit, the law of that State decides which is the
WHUULWRULDOXQLWZKRVHUXOHVVKDOOJRYHUQ,QWKHDEVHQFHRIDQ\VXFKUXOHWKHODZ
RIWKHWHUULWRULDOXQLWZLWKZKLFKWKHFDVHLVPRVWFORVHO\FRQQHFWHGVKDOODSSO\
$UWLFOH
Relationship between the Convention and the Protocol
17KLV&RQYHQWLRQDQGWKH3URWRFROVKDOOEHUHDGDQGLQWHUSUHWHGWRJHWKHU
DVDVLQJOHLQVWUXPHQW
2 7R WKH H[WHQW RI DQ\ LQFRQVLVWHQF\ EHWZHHQ WKLV &RQYHQWLRQ DQG WKH
3URWRFROWKH3URWRFROVKDOOSUHYDLO
CHAPTER II
CONSTITUTION OF AN INTERNATIONAL INTEREST
$UWLFOH
Formal requirements
An interest is constituted as an international interest under this convention
where the agreement creating or providing for the interest:
(a) is in writing;
(b) relates to an object of which the chargor, conditional seller or lessor
has power to dispose;
(c) enables the object to be identified in conformity with the Protocol; and
(d) in the case of a security agreement, enables the secured obligations
to be determined, but without the need to state a sum or maximum sum
VHFXUHG
CHAPTER III
DEFAULT REMEDIES
$UWLFOH
Remedies of chargee
1,QWKHHYHQWRIGHIDXOWDVSURYLGHGLQ$UWLFOHWKHFKDUJHHPD\WRWKH
extent that the chargor has at any time so agreed and subject to any declaration
that may be made by a Contracting State under Article 54, exercise any one or
more of the following remedies:
(a) take possession or control of any object charged to it;
(b) sell or grant a lease of any such object;
(c) collect or receive any income or profits arising from the management
RUXVHRIDQ\VXFKREMHFW
2 7KH FKDUJHH PD\ DOWHUQDWLYHO\ DSSO\ IRU D FRXUW RUGHU DXWKRULVLQJ RU
GLUHFWLQJDQ\RIWKHDFWVUHIHUUHGWRLQWKHSUHFHGLQJSDUDJUDSK
3$Q\UHPHG\VHWRXWLQVXE-paragraphs (a), (b) or (c) of paragraph 1 or by
$UWLFOHVKDOOEHH[HUFLVHGLQDFRPPHUFLDOO\UHDVRQDEOHPDQQHU$UHPHG\
shall be deemed to be exercised in a commercially reasonable manner where it is
exercised in conformity with a provision of the security agreement except where
VXFKDSURYLVLRQLVPDQLIHVWO\XQUHDVRQDEOH
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 9
4$FKDUJHHSURSRVLQJWRVHOORUJUDQWDOHDVHRIDQREMHFWXQGHUSDUDJUDSK
shall give reasonable prior notice in writing of the proposed sale or lease to:
(a) interested persons specified in Article 1(m)(i) and (ii); and
(b) interested persons specified in Article 1(m)(iii) who have given
notice of their rights to the chargee within a reasonable time prior to the sale
RUOHDVH
5$Q\VXPFROOHFWHGRUUHFHLYHGE\WKHFKDUJHHDVDUHVXOWRIH[HUFLVHRI
any of the remedies set out in paragraph 1 or 2 shall be applied towards discharge
RIWKHDPRXQWRIWKHVHFXUHGREOLJDWLRQV
6:KHUHWKHVXPVFROOHFWHG or received by the chargee as a result of the
exercise of any remedy set out in paragraph 1 or 2 exceed the amount secured by
the security interest and any reasonable costs incurred in the exercise of any such
remedy, then unless otherwise ordered by the court the chargee shall distribute the
surplus among holders of subsequently ranking interests which have been
registered or of which the chargee has been given notice, in order of priority, and
SD\DQ\UHPDLQLQJEDODQFHWRWKHFKDUJRU
$UWLFOH
Vesting of object in satisfaction; redemption
1$WDQ\WLPHDIWHUGHIDXOWDVSURYLGHGLQ$UWLFOHWKHFKDUJHHDQGDOOWKH
interested persons may agree that ownership of (or any other interest of the
chargor in) any object covered by the security interest shall vest in the chargee in
RUWRZDUGVVDWLVIDFWLRQRIWKHVHFXUHGREOLJDWLRQV
27KHFRXUWPD\RQWKHDSSOLFDWLRQRIWKHFKDUJHHRUGHUWKDWRZQHUVKLSRI
(or any other interest of the chargor in) any object covered by the security interest
VKDOOYHVWLQWKHFKDUJHHLQRUWRZDUGVVDWLVIDFWLRQRIWKHVHFXUHGREOLJDWLRQV
37KHFRXUWVKDOOJUDQWDQDSSOLFDWLRQXQGHUWKHSUHFHGLQJSDUDJUDSKRQO\
if the amount of the secured obligations to be satisfied by such vesting is
commensurate with the value of the object after taking account of any payment to
EHPDGHE\WKHFKDUJHHWRDQ\RIWKHLQWHUHVWHGSHUVRQV
4$WDQ\WLPHDIWHUGHIDXOWDVSURYLGHGXQGHU$UWLFOHDQGEHIRUHVDOHRI
the charged object or the making of an order under paragraph 2, the chargor or
any interested person may discharge the security interest by paying in full the
amount secured, subject to any lease granted by the chargee under Article 8(1)(b)
or ordered under Article 8(2):KHre, after such default, the payment of the amount
secured is made in full by an interested person other than the debtor, that person
LVVXEURJDWHGWRWKHULJKWVRIWKHFKDUJHH
52ZQHUVKLSRUDQ\RWKHULQWHUHVWRIWKHFKDUJRUSDVVLQJRQDVDOHXQGHU
Article 8(1)(b) or passing under paragraph 1 or 2 of this article is free from any
other interest over which the chargee’s security interest has priority under the
SURYLVLRQVRI$UWLFOH
$UWLFOH
Remedies of conditional seller or lessor
In the event of default under a title reservation agreement or under a leasing
agreement as provided in Article 11, the conditional seller or the lessor, as the
case may be, may:
(a) subject to any declaration that may be made by a Contracting State
under Article 54, terminate the agreement and take possession or control of
any object to which the agreement relates; or
(b) DSSO\IRUDFRXUWRUGHUDXWKRULVLQJRUGLUHFWLQJHLWKHURIWKHVHDFWV
10 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
$UWLFOH
Meaning of default
17KHGHEWRUDQGWKHFUHGLWRUPD\DWDQ\WLPHDJUHHLQZULWLQJDVWRWKH
events that constitute a default or otherwise give rise to the rights and remedies
VSHFLILHGLQ$UWLFOHVWRDQG
2. Where the debtor and the creditor have not so agreed, “default” for the
SXUSRVHVRI$UWLFOHVWRDQGPHDQVDGHIDXOWZKLFKVXEVWDQWLDOO\GHSULYHV
WKHFUHGLWRURIZKDWLWLVHQWLWOHGWRH[SHFWXQGHUWKHDJUHHPHQW
$UWLFOH
Additional remedies
Any additional remedies permitted by the applicable law, including any
remedies agreed upon by the parties, may be exercised to the extent that they are
not inconsistent with the mandatory provisions of this Chapter as set out in
$UWLFOH
$UWLFOH
Relief pending final determination
1 6XEMHFW WR DQ\ GHFODUDWLRQ WKDW LW PD\ PDNH XQGHU $UWLFOH
a Contracting State shall ensure that a creditor who adduces evidence of default
by the debtor may, pending final determination of its claim and to the extent that
the debtor has at any time so agreed, obtain from a court speedy relief in the form
of such one or more of the following orders as the creditor requests:
(a) preservation of the object and its value;
(b) possession, control or custody of the object;
(c) immobilisation of the object; and
(d) lease or, except where covered by sub-paragraphs (a) to (c),
PDQDJHPHQWRIWKHREMHFWDQGWKHLQFRPHWKHUHIURP
2,QPDNLQJDQ\RUGHUXQGHUWKHSUHFHGLQJSDUDJUDSKWKHcourt may impose
such terms as it considers necessary to protect the interested persons in the event
that the creditor:
(a) in implementing any order granting such relief, fails to perform
any of its obligations to the debtor under this Convention or the Protocol; or
(b) fails to establish its claim, wholly or in part, on the final determination
RIWKDWFODLP
3%HIRUHPDNLQJDQ\RUGHUXQGHUSDUDJUDSKWKHFRXUWPD\UHTXLUHQRWLFH
RIWKHUHTXHVWWREHJLYHQWRDQ\RIWKHLQWHUHVWHGSHUVRQV
41RWKLQJLQ this Article affects the application of Article 8(3) or limits the
DYDLODELOLW\RIIRUPVRILQWHULPUHOLHIRWKHUWKDQWKRVHVHWRXWLQSDUDJUDSK
$UWLFOH
Procedural requirements
Subject to Article 54(2), any remedy provided by this Chapter shall be
exercised in conformity with the procedure prescribed by the law of the place
ZKHUHWKHUHPHG\LVWREHH[HUFLVHG
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 11
$UWLFOH
Derogation
In their relations with each other, any two or more of the parties referred to
in this Chapter may at any time, by agreement in writing, derogate from or vary
the effect of any of the preceding provisions of this Chapter except Articles 8(3)
to (6), 9(3) and (4)(2) DQG
CHAPTER IV
THE INTERNATIONAL REGISTRATION SYSTEM
$UWLFOH
The International Registry
1$Q,QWHUQDWLRQDO5HJLVWU\VKDOOEHHVWDEOLVKHGIRUUHJLVWUDWLRQVRI
(a) international interests, prospective international interests and
registrable non-consensual rights and interests;
(b) assignments and prospective assignments of international interests;
(c) acquisitions of international interests by legal or contractual
subrogations under the applicable law;
(d) notices of national interests; and
(e) subordinations of interests referred to in any of the preceding
sub-SDUDJUDSKV
2 'LIIHUHQW LQWHUQDWLRQDO UHJLVWULHV PD\ EH HVWDEOLVKHG IRU GLIIHUHQW
FDWHJRULHVRIREMHFWDQGDVVRFLDWHGULJKWV
3. For the purposes of this Chapter and Chapter V, the term “registration”
includes, where appropriate, an amendment, extension or discharge of a
UHJLVWUDWLRQ
$UWLFOH
The Supervisory Authority and the Registrar
17KHUHVKDOOEHDVXSHUYLVRU\DXWKRULW\DVSURYLGHGE\WKH3URWRFRO
27KHVXSHUYLVRU\DXWKRULW\VKDOO
(a) establish or provide for the establishment of the international
registry;
(b) except as otherwise provided by the Protocol, appoint and dismiss
the Registrar;
(c) ensure that any rights required for the continued effective operation
of the international registry in the event of a change of Registrar will vest in
or be assignable to the new Registrar;
(d) after consultation with the Contracting States, make or approve and
ensure the publication of regulations pursuant to the Protocol dealing with
the operation of the international registry;
(e) establish administrative procedures through which complaints
concerning the operation of the international registry can be made to the
Supervisory Authority;
(f) supervise the Registrar and the operation of the international
registry;
(g) at the request of the Registrar, provide such guidance to the
Registrar as the supervisory authority thinks fit;
(h) set and periodically review the structure of fees to be charged for
the services and facilities of the international registry;
12 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(i) do all things necessary to ensure that an efficient notice-based
electronic registration system exists to implement the objectives of this
Convention and the Protocol; and
(j) report periodically to Contracting States concerning the discharge
of its obligDWLRQVXQGHUWKLV&RQYHQWLRQDQGWKH3URWRFRO
37KHVXSHUYLVRU\DXWKRULW\PD\HQWHULQWRDQ\DJUHHPHQWUHTXLVLWHIRUWKH
performance of its functions, including any agreement referred to in Article 27(3)
47KHVXSHUYLVRU\DXWKRULW\VKDOORZQDOOSURSULetary rights in the databases
DQGDUFKLYHVRIWKH,QWHUQDWLRQDO5HJLVWU\
5 7KH 5HJLVWUDU VKDOO HQVXUH WKH HIILFLHQW RSHUDWLRQ RI WKH LQWHUQDWLRQDO
registry and perform the functions assigned to it by this Convention, the Protocol
DQGWKHUHJXODWLRQV
CHAPTER V
OTHER MATTERS RELATING TO REGISTRATION
$UWLFOH
Registration requirements
17KH3URWRFRODQGUHJXODWLRQVVKDOOVSHFLI\WKHUHTXLUHPHQWVLQFOXGLQJWKH
criteria for the identification of the object:
(a) for effecting a registration (which shall include provision for prior
electronic transmission of any consent from any person whose consent is
required under Article 20);
(b) for making searches and issuing search certificates, and, subject
thereto;
(c) for ensuring the confidentiality of information and documents of
the International Registry other than information and documents relating to
DUHJLVWUDWLRQ
27KH5HJLVWUDUVKall not be under a duty to enquire whether a consent to
UHJLVWUDWLRQXQGHU$UWLFOHKDVLQIDFWEHHQJLYHQRULVYDOLG
3 :KHUH DQ LQWHUHVW UHJLVWHUHG DV D SURVSHFWLYH LQWHUQDWLRQDO LQWHUHVW
becomes an international interest, no further registration shall be required
provided that the registration information is sufficient for a registration of an
LQWHUQDWLRQDOLQWHUHVW
4 7KH 5HJLVWUDU VKDOO DUUDQJH IRU UHJLVWUDWLRQV WR EH HQWHUHG LQWR WKH
International Registry database and made searchable in chronological order of
UHFHLSWDQGWKHILOHVKDOOUHFRUGWKHGDWHDQGWLPHRIUHFHLSW
57KH3URWRFROPD\SURYLGHWKDWD&RQWUDFWLQJ6WDWHPD\GHVLJQDWHDQHQWLW\
or entities in its territory as the entry point or entry points through which the
information required for registration shall or may be transmitted to the
,QWHUQDWLRQDO 5HJLVWU\ $ &RQWUDFWLQJ 6WDWH PDNLQJ VXFK D GHVLJQDWLRQ PD\
specify the requirements, if any, to be satisfied before such information is
WUDQVPLWWHGWRWKH,QWHUQDWLRQDO5HJLVWU\
$UWLFOe 19
Validity and time of registration
1$UHJLVWUDWLRQVKDOOEHYDOLGRQO\LIPDGHLQFRQIRUPLW\ZLWK$UWLFOH
2 $ UHJLVWUDWLRQ LI YDOLG VKDOO EH FRPSOHWH XSRQ HQWU\ RI WKH UHTXLUHG
information into the International Registry database so as to be sHDUFKDEOH
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 13
3 $ UHJLVWUDWLRQ VKDOO EH VHDUFKDEOH IRU WKH SXUSRVHV RI WKH SUHFHGLQJ
paragraph at the time when:
(a) the International Registry has assigned to it a sequentially ordered
file number; and
(b) the registration information, including the file number, is stored in
GXUDEOHIRUPDQGPD\EHDFFHVVHGDWWKH,QWHUQDWLRQDO5HJLVWU\
4 ,I DQ LQWHUHVW ILUVW registered as a prospective international interest
becomes an international interest, that international interest shall be treated as
registered from the time of registration of the prospective international interest
provided that the registration was still current immediately before the
LQWHUQDWLRQDOLQWHUHVWZDVFRQVWLWXWHGDVSURYLGHGE\$UWLFOH
5 7KH SUHFHGLQJ SDUDJUDSK DSSOLHV ZLWK QHFHVVDU\ PRGLILFDWLRQV WR WKH
UHJLVWUDWLRQRIDSURVSHFWLYHDVVLJQPHQWRIDQLQWHUQDWLRQDOLQWHUHVW
6 $registration shall be searchable in the International Registry database
DFFRUGLQJWRWKHFULWHULDSUHVFULEHGE\WKH3URWRFRO
$UWLFOH
Consent to registration
1 $Q LQWHUQDWLRQDO LQWHUHVW D SURVSHFWLYH LQWHUQDWLRQDO LQWHUHVW RU DQ
assignment or prospective assignment of an international interest may be
registered, and any such registration amended or extended prior to its expiry, by
HLWKHUSDUW\ZLWKWKHFRQVHQWLQZULWLQJRIWKHRWKHU
2 7KH VXERUGLQDWLRQ RI DQLQWHUQDWLRQDO LQWHUHVW WR DQRWKHU LQWHUQDtional
interest may be registered by or with the consent in writing at any time of the
SHUVRQZKRVHLQWHUHVWKDVEHHQVXERUGLQDWHG
3 $UHJLVWUDWLRQPD\EHGLVFKDUJHGE\RUZLWKWKHFRQVHQWLQZULWLQJRIWKH
SDUW\LQZKRVHIDYRXULWZDVPDGH
4 7KH DFTXLsition of an international interest by legal or contractual
VXEURJDWLRQPD\EHUHJLVWHUHGE\WKHVXEURJHH
5 $UHJLVWUDEOHQRQ-consensual right or interest may be registered by the
KROGHUWKHUHRI
6 $QRWLFHRIDQDWLRQDOLQWHUHVWPD\EHUHJLVWHUHGE\WKHKROGHUWKHUHRI
$UWLFOH
Duration of registration
Registration of an international interest remains effective until discharged
RUXQWLOH[SLU\RIWKHSHULRGVSHFLILHGLQWKHUHJLVWUDWLRQ
$UWLFOH
Searches
1 $Q\ SHUVRQ PD\ LQ WKH PDQQHU SUHVFULEHG by the Protocol and
regulations, make or request a search of the International Registry by electronic
means concerning interests or prospective international interests registered
WKHUHLQ
2 8SRQUHFHLSWRIDUHTXHVWWKHUHIRUWKH5HJLVWUDULQWKHPDQQHUprescribed
by the Protocol and regulations, shall issue a registry search certificate by
electronic means with respect to any object:
(a) stating all registered information relating thereto, together with
a statement indicating the date and time of registration of such
information; or
14 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(b) stating that there is no information in the International Registry
UHODWLQJWKHUHWR
3$VHDUFKFHUWLILFDWHLVVXHGXQGHUWKHSUHFHGLQJSDUDJUDSKVKDOOLQGLFDWH
that the creditor named in the registration information has acquired or intends to
acquire an international interest in the object but shall not indicate whether what
is registered is an international interest or a prospective international interest, even
LIWKLVLVDVFHUWDLQDEOHIURPWKHUHOHYDQWUHJLVWUDWLRQLQIRUPDWLRQ
$UWLFOH
List of declarations and declared non-consensual rights or interests
The Registrar shall maintain a list of declarations, withdrawals of
declaration and of the categories of non-consensual right or interest
communicated to the Registrar by the Depositary as having been declared by
&RQWUDFWLQJ6WDWHVLQFRQIRUPLW\ZLWK$UWLFOHV DQGDQGWKHGDWHRIHDFKVXFK
GHFODUDWLRQ RU ZLWKGUDZDO RI GHFODUDWLRQ 6XFK OLVW VKDOO EH UHFRUGHG DQG
searchable in the name of the declaring State and shall be made available as
provided iQWKH3URWRFRODQGUHJXODWLRQVWRDQ\SHUVRQUHTXHVWLQJLW
$UWLFOH
Evidentiary value of certificates
A document in the form prescribed by the regulations which purports to be
a certificate issued by the International Registry is prima facie proof,––
(a) that it has been so issued; and
(b) of the facts recited in it, including the date and time of a
UHJLVWUDWLRQ
$UWLFOH
Discharge of registration
1:KHUHWKHREOLJDWLRQVVHFXUHGE\DUHJLVWHUHGVHFXULW\LQWHUHVWRUWKH
obligations giving rise to a registered non-consensual right or interest have been
discharged, or where the conditions of transfer of title under a registered title
reservation agreement have been fulfilled, the holder of such interest shall,
without undue delay, procure the discharge of the registration after written
demand by the debtor delivered to or received at its address stated in the
UHJLVWUDWLRQ
2:KHUHDSURVSHFWLYHLQWHUQDWLRQDOLQWHUHVWRUDSURVSHFWLYHDVVLJQPHQWRI
an international interest has been registered, the intending creditor or intending
assignee shall, without undue delay, procure the discharge of the registration after
written demand by the intending debtor or assignor which is delivered to or
received at its address stated in the registration before the intending creditor or
DVVLJQHHKDVJLYHQYDOXHRULQFXUUHGDFRPPLWPHQWWRJLYHYDOXH
3 :KHUH WKH REOLJDWLRQV VHFXUHG E\ D QDWLRQDO LQWHUHVW VSHFLILHG LQ D
registered notice of a national interest have been discharged, the holder of such
interest shall, without undue delay, procure the discharge of the registration after
written demand by the debtor delivered to or received at its address stated in the
UHJLVWUDWLRQ
4:KHUHDUHJLVWUDWLRQRXJKWQRWWRKDYHEHHQPDGHRULVLQFRUUHFWWKH
person in whose favour the registration was made shall, without undue delay,
procure its discharge or amendment after written demand by the debtor delivered
WRRUUHFHLYHGDWLWVDGGUHVVVWDWHGLQWKHUHJLVWUDWLRQ
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 15
$UWLFOH
Access to the international registration facilities
No person shall be denied access to the registration and search facilities of
the International Registry on any ground other than its failure to comply with the
SURFHGXUHVSUHVFULEHGE\WKLV&KDSWHU
CHAPTER VI
PRIVILEGES AND IMMUNITIES OF THE SUPERVISORY AUTHORITY AND THE
REGISTRAR
$UWLFOH
Legal personality; immunity
1 7KH 6XSHUYLVRU\ $XWKRULW\ VKDOO KDYH LQWHUQDWLRQDO OHJDO SHUVRQDOLW\
ZKHUHQRWDOUHDG\SRVVHVVLQJVXFKSHUVRQDOLW\
27KH6XSHUYLVRU\$XWKRULty and its officers and employees shall enjoy
VXFKLPPXQLW\IURPOHJDORUDGPLQLVWUDWLYHSURFHVVDVLVVSHFLILHGLQWKH3URWRFRO
3(a) The Supervisory Authority shall enjoy exemption from taxes and such
other privileges as may be provided by agreement wiWKWKHKRVW6WDWH
(b) For the purposes of this paragraph, “host State” means the State in which
WKH6XSHUYLVRU\$XWKRULW\LVVLWXDWHG
47KHDVVHWVGRFXPHQWVGDWDEDVHVDQGDUFKLYHVRIWKH,QWHUQDWLRQDO5HJLVWU\
shall be inviolable and immune from seizure or other legal or administrative
SURFHVV
5)RUWKHSXUSRVHVRIDQ\FODLPDJDLQVWWKH5HJLVWUDUXQGHU$UWLFOH(1) or
Article 44, the claimant shall be entitled to access to such information and
GRFXPHQWVDVDUHQHFHVVDU\WRHQDEOHWKHFODLPDQWWRSXUVXHLWVFODLP
67KH6XSHUYLVRU\$XWKRULW\PD\ZDLYHWKHLQYLRODELOLW\DQGLPPXQLW\
conferred by paragraph 4
CHAPTER VII
LIABILITY OF THE REGISTRAR
$UWLFOH
Liability and financial assurances
17KH5HJLVWUDUVKDOOEHOLDEOHIRUFRPSHQVDWRU\GDPDJHVIRUORVVVXIIHUHG
by a person directly resulting from an error or omission of the Registrar and its
officers and employees or from a malfunction of the international registration
system except where the malfunction is caused by an event of an inevitable and
irresistible nature, which could not be prevented by using the best practices in
current use in the field of electronic registry design and operation, including those
related to back-XSDQGV\VWHPVVHFXULW\DQGQHWZRUNLQJ
27KH5HJLVWUDUVKDOOQRWEHOLDEOHXQGHUWKHSUHFHGLQJSDUDJUDSKIRUIDFWXDO
inaccuracy of registration information received by the Registrar or transmitted by
the Registrar in the form in which it received that information nor for acts or
circumstances for which the Registrar and its officers and employees are not
responsible and arising prior to receipt of registration information at the
International 5HJLVWU\
3&RPSHQVDWLRQXQGHUSDUDJUDSKPD\EHUHGXFHGWRWKHH[WHQWWKDWWKH
SHUVRQZKRVXIIHUHGWKHGDPDJHFDXVHGRUFRQWULEXWHGWRWKDWGDPDJH
16 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
47KH5HJLVWUDUVKDOOSURFXUHLQVXUDQFHRUDILQDQFLDOJXDUDQWHHFRYHULQJ
the liability referred to in this Article to the extent determined by the Supervisory
$XWKRULW\LQDFFRUGDQFHZLWKWKH3URWRFRO
CHAPTER VIII
EFFECTS OF AN INTERNATIONAL INTEREST AS AGAINST THIRD PARTIES
$UWLFOH
Priority of competing interests
1$ registered interest has priority over any other interest subsequently
UHJLVWHUHGDQGRYHUDQXQUHJLVWHUHGLQWHUHVW
27KHSULRULW\RIWKHILUVW-mentioned interest under the preceding paragraph
applies,—
(a) even if the first-mentioned interest was acquired or registered with
actual knowledge of the other interest; and
(b) even as regards value given by the holder of the first-mentioned
LQWHUHVWZLWKVXFKNQRZOHGJH
37KHEX\HURIDQREMHFWDFTXLUHVLWVLQWHUHVWLQLW—
(a) subject to an interest registered at the time of its acquisition of that
interest; and
(b) free from an unregistered interest even if it has actual knowledge
RIVXFKDQLQWHUHVW
47KHFRQGLWLRQDOEX\HURUOHVVHHDFTXLUHVLWVLQWHUHVWLQRUULJKWRYHUWKDW
object,—
(a) subject to an interest registered prior to the registration of the
international interest held by its conditional seller or lessor; and
(b) free from an interest not so registered at that time even if it has
DFWXDONQRZOHGJHRIWKDWLQWHUHVW
57KHSULRULW\RIcompeting interests or rights under this Article may be
varied by agreement between the holders of those interests, but an assignee of a
subordinated interest is not bound by an agreement to subordinate that interest
unless at the time of the assignment a subordination had been registered relating
WRWKDWDJUHHPHQW
6$Q\SULRULW\JLYHQE\WKLV$UWLFOHWRDQLQWHUHVWLQDQREMHFWH[WHQGVWR
proceeds
77KLV&RQYHQWLRQ—
(a) does not affect the rights of a person in an item, other than an
object, held prior to its installation on an object if under the applicable law
those rights continue to exist after the installation; and
(b) does not prevent the creation of rights in an item, other than an
object, which has previously been installed on an object where under the
DSSOLFDEOHODZWKRVHULJKWVDUHFUHDWHG
$UWLFOH
Effects of insolvency
1,QLQVROYHQF\SURFHHGLQJVDJDLQVWWKHGHEWRUDQLQWHUQDWLRQDOLQWHUHVWLV
effective if prior to the commencement of the insolvency proceedings that interest
was UHJLVWHUHGLQFRQIRUPLW\ZLWKWKLV&RQYHQWLRQ
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 17
2 1RWKLQJ LQ WKLV $UWLFOH LPSDLUV WKH HIIHFWLYHQHVV RI DQ LQWHUQDWLRQDO
interest in the insolvency proceedings where that interest is effective under the
DSSOLFDEOHODZ
31RWKLQJLQWKLV$UWLFOHaffects,—
(a) any rules of law applicable in insolvency proceedings relating to
the avoidance of a transaction as a preference or a transfer in fraud of
creditors; or
(b) any rules of procedure relating to the enforcement of rights to
property which is under the control or supervision of the insolvency
DGPLQLVWUDWRU
CHAPTER IX
ASSIGNMENTS OF ASSOCIATED RIGHTS AND INTERNATIONAL INTERESTS;
RIGHTS OF SUBROGATION
$UWLFOH
Effects of assignment
1([FHSWDVRWKHUZLVHDJUHHGE\WKHSDUWLHVDQassignment of associated
ULJKWVPDGHLQFRQIRUPLW\ZLWK$UWLFOHDOVRWUDQVIHUVWRWKHDVVLJQHH—
(a) the related international interest; and
(b) all the interests and priorities of the assignor under this
&RQYHQWLRQ
21RWKLQJLQWKLVConvention prevents a partial assignment of the assignor’s
DVVRFLDWHG ULJKWV ,Q WKH FDVH RI VXFK D SDUWLDO DVVLJQPHQW WKH DVVLJQRU DQG
assignee may agree as to their respective rights concerning the related
international interest assigned under the preceding paragraph but not so as
DGYHUVHO\WRDIIHFWWKHGHEWRUZLWKRXWLWVFRQVHQW
36XEMHFWWRSDUDJUDSKWKHDSSOLFDEOHODZVKDOOGHWHUPLQHWKHGHIHQFHV
and rights of set-RIIDYDLODEOHWRWKHGHEWRUDJDLQVWWKHDVVLJQHH
47KHGHEWRUPD\DWDQ\WLPHE\agreement in writing waive all or any of
the defences and rights of set-off referred to in the preceding paragraph other than
GHIHQFHVDULVLQJIURPIUDXGXOHQWDFWVRQWKHSDUWRIWKHDVVLJQHH
5,QWKHFDVHRIDQDVVLJQPHQWE\ZD\RIVHFXULW\WKHDVVLJQHd associated
rights revest in the assignor, to the extent that they are still subsisting, when the
REOLJDWLRQVVHFXUHGE\WKHDVVLJQPHQWKDYHEHHQGLVFKDUJHG
$UWLFOH
Formal requirements of assignment
1 $Q DVVLJQPHQW RI DVVRFLDWHG ULJKWV WUDQVIHUV WKH related international
interest only if it,—
(a) is in writing;
(b) enables the associated rights to be identified under the contract
from which they arise; and
(c) in the case of an assignment by way of security, enables the
obligations secured by the assignment to be determined in accordance with
WKH3URWRFROEXWZLWKRXWWKHQHHGWRVWDWHDVXPRUPD[LPXPVXPVHFXUHG
2$QDVVLJQPHQWRIDQLQWHUQDWLRQDOLQWHUHVWFUHDWHGRUSURYLGHGIRUE\D
security agreement is not valid unless some or all related associated rights also are
DVVLJQHG
18 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
37KLV&RQYHQWLRQGRHVQRWDSSO\WRDQDVVLJQPHQWRIDVVRFLDWHGULJKWV
ZKLFKLVQRWHIIHFWLYHWRWUDQVIHUWKHUHODWHGLQWHUQDWLRQDOLQWHUHVW
$UWLFOH
Debtor’s duty to assignee
17RWKHH[WHQWWKDWassociated rights and the related international interest
KDYHEHHQWUDQVIHUUHGLQDFFRUGDQFHZLWK$UWLFOHVDQGWKHGHEWRULQUHODWLRQ
to those rights and that interest is bound by the assignment and has a duty to make
payment or give other performance to the assignee, if but only if,—
(a) the debtor has been given notice of the assignment in writing by or
with the authority of the assignor; and
(b) WKHQRWLFHLGHQWLILHVWKHDVVRFLDWHGULJKWV
2,UUHVSHFWLYHRIDQ\RWKHUJURXQGRQZKLFKSD\PHQWRUSHrformance by the
debtor discharges the latter from liability, payment or performance shall be
HIIHFWLYHIRUWKLVSXUSRVHLIPDGHLQDFFRUGDQFHZLWKWKHSUHFHGLQJSDUDJUDSK
31RWKLQJLQWKLV$UWLFOHVKDOODIIHFWWKHSULRULW\RIFRPSHWLQJDVVLJQPHQWV
ArtiFOH
Default remedies in respect of assignment by way of security
In the event of default by the assignor under the assignment of associated
rights and the related international interest made by way of security, Articles 8, 9
and 11 to 14 apply in the relations between the assignor and the assignee (and, in
relation to associated rights, apply in so far as those provisions are capable of
application to intangible property) as if references,—
(a) to the secured obligation and the security interest were references to the
obligation secured by the assignment of the associated rights and the related
international interest and the security interest created by that assignment;
(b) to the chargee or creditor and chargor or debtor were references to the
assignee and assignor;
(c) to the holder of the international interest were references to the assignee;
and
(d) to the object were references to the assigned associated rights and the
related international interest
$UWLFOH
Priority of competing assignments
1:KHUHWKHUHDUHFRPSHWLQJDVVLJQPHQWVRIDVVRFLDWHGULJKWVDQGDWOHDVW
one of the assignments includes the related international interest and is registered,
the provisions of Article 29 apply as if the references to a registered interest were
references to an assignment of the associated rights and the related registered
interest and as if references to a registered or unregistered interest were references
to a registered or uQUHJLVWHUHGDVVLJQPHQW
2$UWLFOHDSSOLHVWRDQDVVLJQPHQWRIDVVRFLDWHGULJKWVDVLIWKHUHIHUHQFHV
to an international interest were references to an assignment of the associated
ULJKWVDQGWKHUHODWHGLQWHUQDWLRQDOLQWHUHVW
$UWLFOH
Assignee’s priority with respect to associated rights
17KHDVVLJQHHRIDVVRFLDWHGULJKWVDQGWKHUHODWHGLQWHUQDWLRQDOLQWHUHVW
ZKRVHDVVLJQPHQWKDVEHHQUHJLVWHUHGRQO\KDVSULRULW\XQGHU$UWLFOH(1) over
another assignee of the associated rights:
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 19
(a) if the contract under which the associated rights arise states that
they are secured by or associated with the object; and
(b) WRWKHH[WHQWWKDWWKHDVVRFLDWHGULJKWVDUHUHODWHGWRDQREMHFW
2 )RU WKH SXUSRVHV RI VXE-paragraph (b) of the preceding paragraph,
associated rights are related to an object only to the extent that they consist of
rights to payment or performance that relate to:
(a) a sum advanced and utilised for the purchase of the object;
(b) a sum advanced and utilised for the purchase of another object in
which the assignor held another international interest if the assignor
transferred that interest to the assignee and the assignment has been
registered;
(c) the price payable for the object;
(d) the rentals payable in respect of the object; or
(e) other obligations arising from a transaction referred to in any of the
preceding sub-SDUDJUDSKV
3 ,Q DOO RWKHU FDVHV WKH SULRULW\ RI WKH FRPSHWLQJ DVVLJQPHQWV RI WKH
DVVRFLDWHGULJKWVVKDOOEHGHWHUPLQHGE\WKHDSSOLFDEOHODZ
$UWLFOH
Effects of assignor’s insolvency
7KHSURYLVLRQVRI$UWLFOHDSSO\WRLQVROYHQF\SURFHHGLQJVDJDLQVWWKH
DVVLJQRUDVLIUHIHUHQFHVWRWKHGHEWRUZHUHUHIHUHQFHVWRWKHDVVLJQRU
$UWLFOH
Subrogation
16XEMHFWWRSDUDJUDSKQRWKLQJLQWKLV&RQYHQWLRQDIIHFts the acquisition
of associated rights and the related international interest by legal or contractual
VXEURJDWLRQXQGHUWKHDSSOLFDEOHODZ
27KHSULRULW\EHWZHHQDQ\LQWHUHVWZLWKLQWKHSUHFHGLQJSDUDJUDSKDQGD
competing interest may be varied by agreement in writing between the holders of
the respective interests but an assignee of a subordinated interest is not bound by
an agreement to subordinate that interest unless at the time of the assignment a
subordination had been registered relating to tKDWDJUHHPHQW
CHAPTER X
RIGHTS OR INTERESTS SUBJECT TO DECLARATIONS BY CONTRACTING
STATES
$UWLFOH
Rights having priority without registration
1$&RQWUDFWLQJ6WDWHPD\DWDQ\WLPHLQDGHFODUDWLRQGHSRVLWHGZLWKWKH
Depositary of the Protocol declare, generally or specifically:
(a) those categories of non-consensual right or interest (other than a
right or interest to which Article 40 applies) which under that State’s law
have priority over an interest in an object equivalent to that of the holder of
a registered international interest and which shall have priority over a
registered international interest, whether in or outside insolvency
proceedings; and
20 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(b)that nothing in this Convention shall affect the right of a State or
State entity, intergovernmental organisation or other private provider of
public services to arrest or detain an object under the laws of that State for
payment of amounts owed to such entity, organisation or provider directly
UHODWLQJWRWKRVHVHUYLFHVLQUHVSHFWRIWKDWREMHFWRUDQRWKHUREMHFW
2A declaration made under the preceding paragraph may be expressed to
cover categories that are created after the deposit of that declaratioQ
3 $ QRQ-consensual right or interest has priority over an international
interest if and only if the former is of a category covered by a declaration
GHSRVLWHGSULRUWRWKHUHJLVWUDWLRQRIWKHLQWHUQDWLRQDOLQWHUHVW
4 Notwithstanding the preceding paragraph, a Contracting State may, at
the time of ratification, acceptance, approval of, or accession to the Protocol,
declare that a right or interest of a category covered by a declaration made
under sub-paragraph (a) of paragraph 1 shall have priority over an
international interest registered prior to the date of such ratification,
acceptance, approval or DFFHVVLRQ
$UWLFOH
Registrable non-consensual rights or interests
A Contracting State may at any time in a declaration deposited with the
Depositary of the Protocol list the categories of non-consensual right or interest
which shall be registrable under this Convention as regards any category of object
as if the right or interest were an international interest and shall be regulated
accoUGLQJO\6XFKDGHFODUDWLRQPD\EHPRGLILHGIURPWLPHWRWLPH
CHAPTER XI
APPLICATION OF THE CONVENTION TO SALES
$UWLFOH
Sale and prospective sale
This Convention shall apply to the sale or prospective sale of an object as
provided for in the Protocol wLWKDQ\PRGLILFDWLRQVWKHUHLQ
CHAPTER XII
JURISDICTION
$UWLFOH
Choice of forum
1 6XEMHFWWR$UWLFOHVDQGWKHFRXUWVRID&RQWUDFWLQJ6WDWHFKRVHQE\
the parties to a transaction have jurisdiction in respect of any claim brought under
this Convention, whether or not the chosen forum has a connection with the
SDUWLHVRUWKHWUDQVDFWLRQ6XFKMXULVGLFWLRQVKDOOEHH[FOXVLYHXQOHVVRWKHUZLVH
DJUHHGEHWZHHQWKHSDUWLHV
2 $Q\ VXFK DJUHHPHQW VKDOO EH LQ ZULWLQJ RU RWKHUZLVH FRQFOXGHG LQ
accordance wiWKWKHIRUPDOUHTXLUHPHQWVRIWKHODZRIWKHFKRVHQIRUXP
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 21
$UWLFOH
Jurisdiction under Article 13
17KHFRXUWVRID&RQWUDFWLQJ6WDWHFKRVHQE\WKHSDUWLHVDQGWKHFRXUWVRI
the Contracting State on the territory of which the object is situated have
MXULVGLFWLRQWRJUDQWUHOLHIXQGHU$UWLFOH(1)(a), (b), (c) DQG$UWLFOH(4) in
UHVSHFWRIWKDWREMHFW
2-XULVGLFWLRQWRJUDQWUHOLHIXQGHU$UWLFOH(1)(d) or other interim relief
E\YLUWXHRI$UWLFOH(4) may be exercised either:
(a) by the courts chosen by the parties; or
(b) by the courts of a Contracting State on the territory of which the
debtor is situated, being relief which, by the terms of the order granting it,
LVHQIRUFHDEOHRQO\LQWKHWHUULWRU\RIWKDW&RQWUDFWLQJ6WDWH
3 A court has jurisdiction under the preceding paragraphs even if the final
GHWHUPLQDWLRQRIWKHFODLPUHIHUUHGWRLQ$UWLFOH(1) will or may take place in a
FRXUWRIDQRWKHU&RQWUDFWLQJ6WDWHRUE\DUELWUDWLRQ
$UWLFOH
Jurisdiction to make orders against the Registrar
1 7KH FRXUWV RI WKH SODFH LQ ZKLFK WKH 5HJLVWUDU KDV LWV FHQWUH RI
administration shall have exclusive jurisdiction to award damages or make orders
DJDLQVWWKH5HJLVWUDU
2:KHUHDSHUVRQIDLOVWRUHVSRQGWRDGHPDQGPDGHXQGHU$UWLFOH25 and
that person has ceased to exist or cannot be found for the purpose of enabling an
order to be made against it requiring it to procure discharge of the registration, the
courts referred to in the preceding paragraph shall have exclusive jurisdiction, on
the application of the debtor or intending debtor, to make an order directed to the
5HJLVWUDUUHTXLULQJWKH5HJLVWUDUWRGLVFKDUJHWKHUHJLVWUDWLRQ
3:KHUHDSHUVRQIDLOVWRFRPSO\ZLWKDQRUGHURIDFRXUWKDYLQJMXULVGLFWLRQ
under this Convention or, in the case of a national interest, an order of a court of
competent jurisdiction requiring that person to procure the amendment or
discharge of a registration, the courts referred to in paragraph 1 may direct the
Registrar to take such steps as will givHHIIHFWWRWKDWRUGHU
4([FHSWDVRWKHUZLVHSURYLGHGE\WKHSUHFHGLQJSDUDJUDSKVQRFRXUWPD\
make orders or give judgments or rulings against or purporting to bind the
5HJLVWUDU
$UWLFOH
Jurisdiction in respect of insolvency proceedings
The SURYLVLRQVRIWKLV&KDSWHUDUHQRWDSSOLFDEOHWRLQVROYHQF\SURFHHGLQJV
CHAPTER XIII
RELATIONSHIP WITH OTHER CONVENTIONS
$UWLFOHELV
Relationship with the United Nations Convention on the Assignment of
Receivables in International Trade
This Convention shall prevail over the United Nations Convention on the
Assignment of Receivables in International Trade, opened for signature in New
York on 12 December 2001, as it relates to the assignment of receivables which
are associated rights related to international interests in aircraft objects, railway
UROOLQJVWRFNDQGVSDFHDVVHWV
22 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
$UWLFOH
Relationship with the UNIDROIT Convention on International Financial
Leasing
The Protocol may determine the relationship between this Convention and
the UNIDROIT Convention on International Financial Leasing, signed at Ottawa
RQ0D\
CHAPTER XIV
FINAL PROVISIONS
$UWLFOH
Signature, ratification, acceptance, approval or accession
1 7KLV &RQYHQWLRQ VKDOO EH RSHQ IRU VLJQDWXUH LQ &DSH 7RZQ RQ
16 November 2001 by States participating in the Diplomatic Conference to Adopt
a Mobile Equipment Convention and an Aircraft Protocol held at Cape Town from
2FWREHUWR1RYHPEHU$IWHU1RYHPEHUWKH&RQYHQWLRQVKDOO
be open to all States for signature at the Headquarters of the International Institute
for the Unification of Private Law (UNIDROIT) in Rome until it enters into force
LQDFFRUGDQFHZLWK$UWLFOH
27KLV&RQYHQWLRQVKDOOEHVXEMHFWWRUDWLILFDWLRQDFFHStance or approval
E\6WDWHVZKLFKKDYHVLJQHGLW
3$Q\6WDWHZKLFKGRHVQRWVLJQWKLV&RQYHQWLRQPD\DFFHGHWRLWDWDQ\
WLPH
45DWLILFDWLRQDFFHSWDQFHDSSURYDORUDFFHVVLRQLVHIIHFWHGE\WKHGHSRVLW
of a formal instrument to that effect with the DeSRVLWDU\
$UWLFOH
Regional Economic Integration Organisations
1$5HJLRQDO(FRQRPLF,QWHJUDWLRQ2UJDQLVDWLRQZKLFKLVFRQVWLWXWHGE\
sovereign States and has competence over certain matters governed by this
Convention may similarly sign, accept, approvHRUDFFHGHWRWKLV&RQYHQWLRQ7KH
Regional Economic Integration Organisation shall in that case have the rights and
obligations of a Contracting State, to the extent that that Organisation has
FRPSHWHQFH RYHU PDWWHUV JRYHUQHG E\ WKLV&RQYHQWLRQ :KHUH WKe number of
Contracting States is relevant in this Convention, the Regional Economic
Integration Organisation shall not count as a Contracting State in addition to its
0HPEHU6WDWHVZKLFKDUH&RQWUDFWLQJ6WDWHV
27KH5HJLRQDO(FRQRPLFIntegration Organisation shall, at the time of
signature, acceptance, approval or accession, make a declaration to the Depositary
specifying the matters governed by this Convention in respect of which
competence has been transferred to that Organisation by LWV0HPEHU6WDWHV7KH
Regional Economic Integration Organisation shall promptly notify the Depositary
of any changes to the distribution of competence, including new transfers of
FRPSHWHQFHVSHFLILHGLQWKHGHFODUDWLRQXQGHUWKLVSDUDJUDSK
3$Q\UHIHUence to a “Contracting State” or “Contracting States” or “State
Party” or “States Parties” in this Convention applies equally to a Regional
(FRQRPLF,QWHJUDWLRQ2UJDQLVDWLRQZKHUHWKHFRQWH[WVRUHTXLUHV
$UWLFOH
Entry into force
17KLV&RQYHQWLRQHQWHrs into force on the first day of the month following
the expiration of three months after the date of the deposit of the third instrument
of ratification, acceptance, approval or accession but only as regards a category
of objects to which a Protocol applies:
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 23
(a) as from the time of entry into force of that Protocol;
(b) subject to the terms of that Protocol; and
(c) DVEHWZHHQ6WDWHV3DUWLHVWRWKLV&RQYHQWLRQDQGWKDW3URWRFRO
2 )RURWKHU6WDWHVWKLV&RQYHQWLRQHQWHUVLQWRIRUFHRQWKHILUVWGD\RIWKH
month following the expiration of three months after the date of the deposit of
their instrument of ratification, acceptance, approval or accession but only as
regards a category of objects to which a Protocol applies and subject, in relation
to such Protocol, to the requirements of sub-paragraphs (a), (b) and (c) of the
SUHFHGLQJSDUDJUDSK
$UWLFOH
Internal transactions
1 $&RQWUDFWLQJ6WDWHPD\DWWKHWLPHRIratification, acceptance, approval
of, or accession to the Protocol, declare that this Convention shall not apply to a
transaction which is an internal transaction in relation to that State with regard to
DOOW\SHVRIREMHFWVRUVRPHRIWKHP
2 1RWZLWKVWDnding the preceding paragraph, the provisions of Articles 8(4),
9(1), 16, Chapter V, Article 29, and any provisions of this Convention relating to
UHJLVWHUHGLQWHUHVWVVKDOODSSO\WRDQLQWHUQDOWUDQVDFWLRQ
3 :KHUHQRWLFHRIDQDWLRQDOLQWHUHVWKDVEHHQregistered in the International
Registry, the priority of the holder of that interest under Article 29 shall not be
affected by the fact that such interest has become vested in another person by
DVVLJQPHQWRUVXEURJDWLRQXQGHUWKHDSSOLFDEOHODZ
$UWLFOH1
Future Protocols
1 7KH'HSRVLWDU\PD\FUHDWHZRUNLQJJURXSVLQFR-operation with such
relevant non-governmental organisations as the Depositary considers appropriate,
to assess the feasibility of extending the application of this Convention, through
one or more Protocols, to objects of any category of high-value mobile equipment,
other than a category referred to in Article 2(3), each member of which is uniquely
LGHQWLILDEOHDQGDVVRFLDWHGULJKWVUHODWLQJWRVXFKREMHFWV
2 The Depositary shall communicate the text of any preliminary draft
Protocol relating to a category of objects prepared by such a working group to all
States Parties to this Convention, all member States of the Depositary, member
States of the United Nations which are not members of the Depositary and the
relevant intergovernmental organisations, and shall invite such States and
organisations to participate in intergovernmental negotiations for the completion
RIDGUDIW3URWRFRORQWKHEDVLVRIVXFKDSUHOLPLQDU\GUDIW3URWRFRO
3The Depositary shall also communicate the text of any preliminary draft
Protocol prepared by such a working group to such relevant non-governmental
organisations as the Depositary considers DSSURSULDWH6XFK non-governmental
organisations shall be invited promptly to submit comments on the text of the
preliminary draft Protocol to the Depositary and to participate as observers in the
SUHSDUDWLRQRIDGUDIW3URWRFRO
4 When the competent bodies of the Depositary adjudge such a draft
Protocol ripe for adoption, the Depositary shall convene a diplomatic conference
IRULWVDGRSWLRQ
5 Once such a Protocol has been adopted, subject to paragraph 6, this
Convention shall appl\WRWKHFDWHJRU\RIREMHFWVFRYHUHGWKHUHE\
24 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
6 $UWLFOH ELV RI WKLV Convention applies to such a Protocol only if
VSHFLILFDOO\SURYLGHGIRULQWKDW3URWRFRO
$UWLFOH
Territorial units
1,ID&RQWUDFWLQJ6WDWHKDVWHUULWRULDOXQLWVLQZKLFKGLIIHUHQWV\VWHPVRI
law are applicable in relation to the matters dealt with in this Convention, it may,
at the time of ratification, acceptance, approval or accession, declare that this
Convention is to extend to all its territorial units or only to one or more of them
and may modify its declaration by submitting another declaration DWDQ\WLPH
2$Q\VXFKGHFODUDWLRQVKDOOVWDWHH[SUHVVO\WKHWHUULWRULDOXQLWVWRZKLFK
WKLV&RQYHQWLRQDSSOLHV
3,ID&RQWUDFWLQJ6WDWHKDVQRWPDGHDQ\GHFODUDWLRQXQGHUSDUDJUDSK
this Convention shall apply to all territorial units of that 6WDWH
4:KHUHD&RQWUDFWLQJ6WDWHH[WHQGVWKLV&RQYHQWLRQWRRQHRUPRUHRILWV
territorial units, declarations permitted under this Convention may be made in
respect of each such territorial unit, and the declarations made in respect of one
territorial unit may be different from those made in respect of another territorial
XQLW
5,IE\YLUWXHRIDGHFODUDWLRQXQGHUSDUDJUDSKWKLV&RQYHQWLRQH[WHQGV
to one or more territorial units of a Contracting State:
(a) the debtor is considered to be situated in a Contracting State only
if it is incorporated or formed under a law in force in a territorial unit to
which this Convention applies or if it has its registered office or statutory
seat, centre of administration, place of business or habitual residence in a
territorial unit to which this Convention applies;
(b) any reference to the location of the object in a Contracting State
refers to the location of the object in a territorial unit to which this
Convention applies; and
(c) any reference to the administrative authorities in that Contracting
State shall be construed as referring to the administrative authorities having
MXULVGLFWLRQLQDWHUULWRULDOXQLWWRZKLFKWKLV&RQYHQWLRQDSSOLHV
$UWLFOH
Determination of courts
A Contracting State may, at the time of ratification, acceptance, approval of,
or accession to the Protocol, declare the relevant “court” or “courts” for the
SXUSRVHVRI$UWLFOHDQG&KDSWHU;,,RIWKLV&RQYHQWLRQ
$UWLFOH
Declarations regarding remedies
1$&RQWUDFWLQJ6WDWHPD\at the time of ratification, acceptance, approval
of, or accession to the Protocol, declare that while the charged object is situated
within, or controlled from its territory the chargee shall not grant a lease of the
REMHFWLQWKDWWHUULWRU\
2$&RQWUDFting State shall, at the time of ratification, acceptance, approval
of, or accession to the Protocol, declare whether or not any remedy available to
the creditor under any provision of this Convention which is not there expressed
to require application to WKHFRXUWPD\EHH[HUFLVHGRQO\ZLWKOHDYHRIWKHFRXUW
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 25
$UWLFOH
Declarations regarding relief pending final determination
A Contracting State may, at the time of ratification, acceptance, approval
of, or accession to the Protocol, declare that it will not apply the provisions of
Article RU$UWLFOHRUERWKZKROO\RULQSDUW7KHGHFODUDWLRQVKDOOVSHFLI\
under which conditions the relevant Article will be applied, in case it will be
applied partly, or otherwise which other forms of iQWHULPUHOLHIZLOOEHDSSOLHG
$UWLFOH
Reservations and declarations
1 1R UHVHUYDWLRQV PD\ EH PDGH WR WKLV &RQYHQWLRQ EXW GHFODUDWLRQV
DXWKRULVHGE\$UWLFOHV DQGPD\EHPDGHLQ
DFFRUGDQFHZLWKWKHVHSURYLVLRQV
2 Any declaration or subsequent declaration or any withdrawal of a
declaration made under this Convention shall be notified in writing to the
'HSRVLWDU\
$UWLFOH
Subsequent declarations
1$6WDWH3DUW\PD\PDNHDVXEVHTXHQWGHFODUDWLRQRWKHUWKDQDGHFOaration
authorised under Article 60, at any time after the date on which this Convention
KDVHQWHUHGLQWRIRUFHIRULWE\QRWLI\LQJWKH'HSRVLWDU\WRWKDWHIIHFW
2$Q\VXFKVXEVHTXHQWGHFODUDWLRQVKDOOWDNHHIIHFWRQWKHILUVWGD\RIWKH
month following the expiration of six months after the date of receipt of the
QRWLILFDWLRQE\WKH'HSRVLWDU\:KHUHDORQJHUSHULRGIRUWKDWGHFODUDWLRQWRWDNH
effect is specified in the notification, it shall take effect upon the expiration of
such longer period after UHFHLSWRIWKHQRWLILFDWLRQE\WKH'HSRVLWDU\
31RWZLWKVWDQGLQJWKHSUHYLRXVSDUDJUDSKVWKLV&RQYHQWLRQVKDOOFRQWLQXH
to apply, as if no such subsequent declarations had been made, in respect of all
rights and interests arising prior to the effective date of any such subsequent
GHFODUDWLRQ
$UWLFOH
Withdrawal of declarations
1$Q\6WDWH3DUW\KDYLQJPDGHDGHFODUDWLRQXQGHUWKLV&RQYHQWLRQRWKHU
than a declaration authorised under Article 60, may withdraw it at any time by
QRWLI\LQJWKH'HSRVLWDU\ Such withdrawal is to take effect on the first day of the
month following the expiration of six months after the date of receipt of the
QRWLILFDWLRQE\WKH'HSRVLWDU\
21RWZLWKVWDQGLQJWKHSUHYLRXVSDUDJUDSKWKLV&RQYHQWLRQVKDOOFRQWLQXH
to apply, as if no such withdrawal of declaration had been made, in respect of all
ULJKWVDQGLQWHUHVWVDULVLQJSULRUWRWKHHIIHFWLYHGDWHRIDQ\VXFKZLWKGUDZDO
$UWLFOH
Denunciations
1$Q\6WDWH3DUW\PD\GHQRXQFHWKLV&RQYHQWLRQE\QRWLILFDWLRQLQZULWLQJ
to thH'HSRVLWDU\
2$Q\VXFKGHQXQFLDWLRQVKDOOWDNHHIIHFWRQWKHILUVWGD\RIWKHPRQWK
following the expiration of twelve months after the date on which notification is
UHFHLYHGE\WKH'HSRVLWDU\
26 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
31RWZLWKVWDQGLQJWKHSUHYLRXVSDUDJUDSKVWKLVConvention shall continue
to apply, as if no such denunciation had been made, in respect of all rights and
LQWHUHVWVDULVLQJSULRUWRWKHHIIHFWLYHGDWHRIDQ\VXFKGHQXQFLDWLRQ
$UWLFOH
Transitional provisions
1 8QOHVV RWKHUZLVH GHFODUHG E\ D &RQWUDFWing State at any time, the
Convention does not apply to a pre-existing right or interest, which retains the
priority it enjoyed under the applicable law before the effective date of this
&RQYHQWLRQ
2)RUWKHSXUSRVHVRI$UWLFOH 1(v) and of determining priority under this
Convention:
(a) “effective date of this Convention” means in relation to a debtor
the time when this Convention enters into force or the time when the State
in which the debtor is situated becomes a Contracting State, whichever is
the later; and
(b) the debtor is situated in a State where it has its centre of administration
or, if it has no centre of administration, its place of business or, if it has more
than one place of business, its principal place of business or, if it has no
place oIEXVLQHVVLWVKDELWXDOUHVLGHQFH
3$&RQWUDFWLQJ6WDWHPD\LQLWVGHFODUDWLRQXQGHUSDUDJUDSKVSHFLI\D
date, not earlier than three years after the date on which the declaration becomes
effective, when this Convention and the Protocol will become applicable, for the
purpose of determining priority, including the protection of any existing priority,
to pre-existing rights or interests arising under an agreement made at a time when
the debtor was situated in a State referred to in sub-paragraph (b) of the preceding
SDUDJUDSKEXWRQO\WRWKHH[WHQWDQGLQWKHPDQQHUVSHFLILHGLQLWVGHFODUDWLRQ
$UWLFOH
Review Conferences, amendments and related matters
17KH'HSRVLWDU\VKDOOSUHSDUHUHSRUWV\HDUO\RUDWVXFKRWKHUWLPHDVWKH
circumstances may require for the States Parties as to the manner in which the
LQWHUQDWLRQDOUHJLPHQHVWDEOLVKHGLQWKLV&RQYHQWLRQKDVRSHUDWHGLQSUDFWLFH,Q
preparing such reports, the Depositary shall take into account the reports of the
Supervisory Authority concerning the functioning of the international registration
V\VWHP
2$WWKHUHTXHVWRIQRWOHVVWKDQWZHQW\-five per cent of the States Parties,
Review Conferences of States Parties shall be convened from time to time by the
Depositary, in consultation with the Supervisory Authority, to consider:
(a) the practical operation of this Convention and its effectiveness in
facilitating the asset-based financing and leasing of the objects covered by
its terms;
(b) the judicial interpretation given to, and the application made of the
terms of this Convention and the regulations;
(c) the functioning of the international registration system, the
performance of the Registrar and its oversight by the Supervisory Authority,
taking into account the reports of the Supervisory Authority; and
(d) whether any modifications to this Convention or the arrangements
UHODWLQJWRWKH,QWHUQDWLRQDO5HJLVWU\DUHGHVLUDEOH
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 27
3 6XEMHFW WR SDUDJUDSK DQ\ DPHQGPHQW WR WKLV &RQYHQWLRQ VKDOO EH
approved by at least a two-thirds majority of States Parties participating in the
Conference referred to in the preceding paragraph and shall then enter into force
in respect of States which have ratified, accepted or approved such amendment
when ratified, accepted, or approved by three States in accordance with the
SURYLVLRQVRI$UWLFOH UHODWLQJWRLWVHQWU\LQWRIRUFH
4:KHUHWKHSURSRVHGDPHQGPHQWWRWKLV&RQYHQWLRQLVLQWHQGHGWRDSSO\
to more than one category of equipment, such amendment shall also be approved
by at least a two-thirds majority of States Parties to each Protocol that are
SDUWLFLSDWLQJLQWKH&RQIHUHQFHUHIHUUHGWRLQSDUDJUDSK
$UWLFOH
Depositary and its functions
1,QVWUXPHQWVRIUDWLILFDWLRQDFFHSWDQFHDSSURYDORUDFFHVVLRQVKDOOEH
deposited with the International Institute for the Unification of Private Law
(UNIDROIT)ZKLFKLVKHUHE\GHVLJQDWHGWKH'HSRVLWDU\
27KH'HSRVLWDU\VKDOO
(a) inform all Contracting States of:
(i) each new signature or deposit of an instrument of ratification,
acceptance, approval or accession, together with the date thereof;
(ii) the date of entry into force of this Convention;
(iii) each declaration made in accordance with this Convention,
together with the date thereof;
(iv) the withdrawal or amendment of any declaration, together
with the date thereof; and
(v) the notification of any denunciation of this Convention
together with the date thereof and the date on which it takes effect;
(b) transmit certified true copies of this Convention to all Contracting
States;
(c) provide the Supervisory Authority and the Registrar with a copy of
each instrument of ratification, acceptance, approval or accession, together
with the date of deposit thereof, of each declaration or withdrawal or
amendment of a declaration and of each notification of denunciation,
together with the date of notification thereof, so that the information
contained therein is easily and fully available; and
(d) SHUIRUPVXFKRWKHUIXQFWLRQVFXVWRPDU\IRUGHSRVLWDULHV
28 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
THE SECOND SCHEDULE
[See clause (i) of sub-section (1) of section @
DECLARATIONS LODGED BY THE REPUBLIC OF INDIA UNDER THE CONVENTION
ON INTERNATIONAL INTERESTS IN MOBILE EQUIPMENT AT THE TIME OF THE DEPOSIT
OF ITS INSTRUMENT OF ACCESSION
(i) )RUP1R[6SHFLILFGHFODUDWLRQXQGHU$UWLFOH (1)(a)@
The following categories of non-consensual right or interest have priority under
its laws over an interest in an aircraft object equivalent to that of the holder of a
registered international interest and shall have priority over a registered international
interest, whether in or outside insolvency proceedings, namely:—
(a) liens in favour of airline employees for unpaid wages arising since the
time of a declared default by that airline under a contract to finance or lease and
aircraft object;
(b) liens or other rights of an authority of India relating to taxes or other
unpaid charges arising from or related to the use of that aircraft object and owed
by the owner or operator of that aircraft object, arising since the time of a default
by that owner or operator under a contract to finance or lease that aircraft object;
and
(c) liens in favour of repairers of an aircraft object in their possession to the
H[WHQWRIVHUYLFHRUVHUYLFHVSHUIRUPHGRQDQGYDOXHDGGHGWRWKDWDLUFUDIWREMHFW
(ii) )RUP1R[*HQHUDOGHFODUDWLRQXQGHU$UWLFOH (1)(b)@
Nothing in the Convention shall affect its right or that of any entity thereof, or
any intergovernmental organisation in which India is a member, or other private
provider of public services in India, to arrest or detain an aircraft object under its laws
for payment of amounts owed to the Government of India, any such entity,
organisation or provider directly relating to the service or services provided by it in
UHVSHFWRIWKDWREMHFWRUDQRWKHUDLUFUDIWREMHFW
(iii) )RUP1R(Declaration under Article 40)
The following categories of non-consensual right or interest shall be registrable
under the Convention as regards any category of aircraft object as if the right or
interest were an international interest and shall be regulated accordingly, namely:—
(a) liens in favour of airline employees for unpaid wages arising prior to
the time of a declared default by that airline under a contract to finance or lease
an aircraft object;
(b) liens or other rights of an authority of India relating to taxes or other
unpaid charges arising from or related to the use of an aircraft object and owed
by the owner or operator of that aircraft object, arising prior to the time of a
declared default by that owner or operator under a contract to finance or lease
that aircraft object; and
(c) rights of a person obtaining a court order permitting attachment of an
DLUFUDIWREMHFWLQSDUWLDORUIXOOVDWLVIDFWLRQRIDOHJDOMXGJPHQW
(iv) )RUP1R(General declaration under Article 52)
7KH&RQYHQWLRQVKDOODSSO\WRDOOLWVWHUULWRULDOXQLWV
(v) )RUP1R('HFODUDWLRQXQGHU$UWLFOH)
All the High Courts within their respective territorial jurisdiction are the
UHOHYDQWFRXUWVIRUWKHSXUSRVHVRI$UWLFOHDQG&KDSWHU;,,RIWKH&RQYHQWLRQ
(vi) )RUP1R[Mandatory declaration under Article 54(2)@
Any and all remedies available to the creditor under the Convention which are
not expressed under the relevant provision thereof to require application to the court
PD\EHH[HUFLVHGZLWKRXWFRXUWDFWLRQDQGZLWKRXWOHDYHRIWKHFRXUW
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 29
DECLARATIONS LODGED BY THE REPUBLIC OF INDIA UNDER THE PROTOCOL TO
THE CONVENTION ON INTERNATIONAL INTERESTS IN MOBILE EQUIPMENT ON
MATTERS SPECIFIC TO AIRCRAFT EQUIPMENT AT THE TIME OF THE DEPOSIT OF ITS
INSTRUMENT OF ACCESSION
(i) )RUP1R [Declaration under Article XXX(1) in respect of
Article VIII@
,QGLDZLOODSSO\$UWLFOH9,,,
(ii) )RUP1R[Declaration under Article XXX(2) in respect of
Article X providing for the application of the entirety of Article X@
India will apply Article X of the Protocol in its entirety and the number of
working days to be used for the purposes of the time limit laid down in
Article X(2) of the Protocol shall be that equal to no more than:
(a) ten (10) working days in respect of the remedies specified in
$UWLFOH(1)(a), (b) and (c) of the Convention (respectively, preservation of
aircraft objects and their value; possession, control or custody of aircraft
objects; and, immobilization of aircraft objects); and
(b) thirty (30) working days in respect of the remedies specified in
Article (1) (d) and (e) of the Convention (respectively, lease or management
of aircraft objects and the income thereof; and, sale and application of
proceeds from aircraft objects)
(iii) )RUP1R[General declaration under Article XXX(3) in
respect of Article XI providing for the application of Alternative A in its
entirety to all types of insolvency proceeding@
India will apply Article XI, Alternative A, of the Protocol in its entirety to
all types of insolvency proceedings, and that the waiting period for the purposes
of Article XI(3) of that Alternative shall be two (2) FDOHQGDUPRQWKV
(iv) )RUP1R[Declaration under Article XXX(1) in respect of Article XII@
,QGLDZLOODSSO\$UWLFOH;,,
(v) )RUP1R[Declaration under Article XXX(1) in respect of Article XIII@
,QGLDZLOODSSO\$UWLFOH;,,,
30 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
THE THIRD SCHEDULE
[See clause (m) of sub-section (1) of VHFWLRQ@
PROVISIONS OF THE PROTOCOL TO THE CONVENTION ON INTERNATIONAL
INTERESTS IN MOBILE EQUIPMENT ON MATTERS SPECIFIC TO AIRCRAFT
EQUIPMENT WHICH SHALL HAVE THE FORCE OF LAW
CHAPTER I
Sphere of application and general provisions
$UWLFOH,
Defined terms
1,QWKLV3URWRFROH[FHSWZKHUHWKHFRQWH[WRWKHUZLVHUHTXLUHVWHUPVXVHG
LQLWKDYHWKHPHDQLQJVVHWRXWLQWKH&RQYHQWLRQ
2,QWKLV3URWRFROWKHIROORZLQJWHUPVDUHHPSOR\HGZLWKWKHPHDQLQJVVHW
out below:
(a) “aircraft” means aircraft as defined for the purposes of the Chicago
Convention which are either airframes with aircraft engines installed
thereon or helicopters;
(b) “aircraft engines” means aircraft engines (other than those used in
military, customs or police services) powered by jet propulsion or turbine or
piston technology and:
(i) in the case of jet propulsion aircraft engines, have at least
1750 lb of thrust or its equivalent; and
(ii) in the case of turbine-powered or piston-powered aircraft
engines, have at least 550 rated take-off shaft horsepower or its
equivalent, together with all modules and other installed, incorporated
or attached accessories, parts and equipment and all data, manuals and
records relating thereto;
(c) “aircraft objects” means airframes, aircraft engines and helicopters;
(d) “aircraft register” means a register maintained by a State or a
common mark registering authority for the purposes of the Chicago
Convention;
(e) “airframes” means airframes (other than those used in military,
customs or police services) that, when appropriate aircraft engines are
installed thereon, are type certified by the competent aviation authority to
transport:
(i) at least eight (8) persons including crew; or
(ii) goods in excess of 2750 kilograms, together with all
installed, incorporated or attached accessories, parts and equipment
(other than aircraft engines), and all data, manuals and records relating
thereto;
(f) “authorised party” means the party referred to in Article XIII(3);
(g) “Chicago Convention” means the Convention on International
Civil Aviation, signed at Chicago on 7 December 1944, as amended, and its
Annexes;
(h) “common mark registering authority” means the authority
maintaining a register in accordance with Article 77 of the Chicago Convention
as implemented by the Resolution adopted on 14 December 1967 by the
Council of the International Civil Aviation Organization on nationality and
registration of aircraft operated by international operating agencies;
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 31
(i) “de-registration of the aircraft” means deletion or removal of the
registration of the aircraft from its aircraft register in accordance with the
Chicago Convention;
(j) “guarantee contract” means a contract entered into by a person as
guarantor;
(k) “guarantor” means a person who, for the purpose of assuring
performance of any obligations in favour of a creditor secured by a security
agreement or under an agreement, gives or issues a suretyship or demand
guarantee or a standby letter of credit or any other form of credit insurance;
(l) “helicopters” means heavier-than-air machines (other than those used in
military, customs or police services) supported in flight chiefly by the reactions of
the air on one or more power-driven rotors on substantially vertical axes and
which are type certified by the competent aviation authority to transport:
(i) at least five (5) persons including crew; or
(ii) goods in excess of 450 kilograms, together with all installed,
incorporated or attached accessories, parts and equipment (including
rotors), and all data, manuals and records relating thereto;
(m) “insolvency-related event” means:
(i) the commencement of the insolvency proceedings; or
(ii) the declared intention to suspend or actual suspension of
payments by the debtor where the creditor’s right to institute insolvency
proceedings against the debtor or to exercise remedies under the
Convention is prevented or suspended by law or State action;
(n) “primary insolvency jurisdiction” means the Contracting State in
which the centre of the debtor’s main interests is situated, which for this
purpose shall be deemed to be the place of the debtor’s statutory seat or, if
there is none, the place where the debtor is incorporated or formed, unless
proved otherwise;
(o) “registry authority” means the national authority or the common
mark registering authority, maintaining an aircraft register in a Contracting
State and responsible for the registration and de-registration of an aircraft in
accordance with the Chicago Convention; and
(p) “State of registry” means, in respect of an aircraft, the State on the
national register of which an aircraft is entered or the State of location of the
common mark registerLQJDXWKRULW\PDLQWDLQLQJWKHDLUFUDIWUHJLVWHU
$UWLFOH,,
$SSOLFDWLRQRI&RQYHQWLRQDVUHJDUGVDLUFUDIWREMHFWV
17KH&RQYHQWLRQVKDOODSSO\LQUHODWLRQWRDLUFUDIWREMHFWVDVSURYLGHGE\
WKHWHUPVRIWKLV3URWRFRO
27KH&RQYHQWLRQDQGWKLVProtocol shall be known as the Convention on
,QWHUQDWLRQDO,QWHUHVWVLQ0RELOH(TXLSPHQWDVDSSOLHGWRDLUFUDIWREMHFWV
$UWLFOH,,,
$SSOLFDWLRQRI&RQYHQWLRQWRVDOHV
The following provisions of the Convention apply as if references to an
agreement creating or providing for an international interest were references to a
contract of sale and as if references to an international interest, a prospective
international interest, the debtor and the creditor were references to a sale, a
prospective sale, the seller and the buyer respectively: $UWLFOHV DQG
Article 16(1)(a); Article 19(4); Article 20(1) (as regards registration of a contract of
sale or a prospective sale); Article 25(2) (as regards a prospective sale); and
$UWLFOH
32 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
In addition, the general provisions of Article 1, Article 5, Chapters IV to
VII, Article 29 [other than Article 29(3) which is replaced by Articles XIV(1) and
(2)@, Chapter X, Chapter XII (RWKHUWKDQ$UWLFOH), Chapter XIII and Chapter
XIV (other than Article 60) VKDOODSSO\WRFRQWUDFWVRIVDOHDQGSURVSHFWLYHVDOHV
$UWLFOH,9
6SKHUHRIDSSOLFDWLRQ
1:LWKRXWSUHMXGLFHWR$UWLFOH(1) of the Convention, the Convention shall
also apply in relation to a helicopter, or to an airframe pertaining to an aircraft,
registered in an aircraft register of a Contracting State which is the State of
registry, and where such registration is made pursuant to an agreement for
registration of the aircraft it is deemed to have been effected at the time of the
DJUHHPHQW
2. For the purposes of the definition of “internal transaction” in Article 1 of
the Convention:
(a) an airframe is located in the State of registry of the aircraft of which
it is a part;
(b) an aircraft engine is located in the State of registry of the aircraft
on which it is installed or, if it is not installed on an aircraft, where it is
physically located; and
(c) a helicopter is located in its State of registry, at the time of the
FRQFOXVLRQRIWKHDJUHHPHQWFUHDWLQJRUSURYLGLQJIRUWKHLQWHUHVW
3 7KH SDUWLHV PD\ E\ DJUHHPHQW LQZULWLQJ H[FOXGHWKH DSSOLFDWLRQ RI
Article XI and, in their relations with each other, derogate from or vary the effect
of any of the provisions of this Protocol except Article IX(2)-(4)
$UWLFOH9
)RUPDOLWLHVHIIHFWVDQGUHJLVWUDWLRQRIFRQWUDFWVRIVDOH
1)RUWKHSXUSRVHVRIWKLV3URWRFRODFRQWUDFWRIVDOHLVRQHZKich:
(a) is in writing;
(b) relates to an aircraft object of which the seller has power to
dispose; and
(c) enables the aircraft object to be identified in conformity with this
3URWRFRO
2$FRQWUDFWRIVDOHWUDQVIHUVWKHLQWHUHVWRIWKHVHOOHULQWKHDLrcraft object
WRWKHEX\HUDFFRUGLQJWRLWVWHUPV
35HJLVWUDWLRQRIDFRQWUDFWRIVDOHUHPDLQVHIIHFWLYHLQGHILQLWHO\5HJLVWUDWLRQ
of a prospective sale remains effective unless discharged or until expiry of the
period, if any, specified in the registraWLRQ
$UWLFOH9,
Representative capacities
A person may enter into an agreement or a sale, and register an international
interest in, or a sale of, an aircraft object, in an agency, trust or other representative
FDSDFLW\,QVXFKFDVHWKDWSHUVRQLVentitled to assert rights and interests under
WKH&RQYHQWLRQ
$UWLFOH9,,
'HVFULSWLRQRIDLUFUDIWREMHFWV
A description of an aircraft object that contains its manufacturer’s serial
number, the name of the manufacturer and its model designation is necessary and
sufficient to identify the object for the purposes of Article 7(c) of the Convention
and Article V(1)(c) RIWKLV3URWRFRO
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 33
$UWLFOH9,,,
&KRLFHRIODZ
17KLV$UWLFOHDSSOLHVRQO\ZKHUHD&RQWUDFWLQJ6WDWHKDVPDGHDGHFODUDWLRQ
pursuant to Article XXX(1
27KHSDUWLHVWRDQDJUHHPHQWRUDFRQWUDFWRIVDOHRUDUHODWHGJXDUDQWHH
contract or subordination agreement may agree on the law which is to govern their
FRQWUDFWXDOULJKWVDQGREOLJDWLRQVZKROO\RULQSDUW
38QOHVVotherwise agreed, the reference in the preceding paragraph to the
law chosen by the parties is to the domestic rules of law of the designated State
or, where that State comprises several territorial units, to the domestic law of the
designated territorial XQLW
CHAPTER II
Default remedies, priorities and assignments
$UWLFOH,;
0RGLILFDWLRQRIGHIDXOWUHPHGLHVSURYLVLRQV
1,QDGGLWLRQWRWKHUHPHGLHVVSHFLILHGLQ&KDSWHU,,,RIWKH&RQYHQWLRQWKH
creditor may, to the extent that the debtor has at any time so agreed and, in the
circumstances, specified in that Chapter:
(a) procure the de-registration of the aircraft; and
(b) procure the export and physical transfer of the aircraft object from
WKHWHUULWRU\LQZKLFKLWLVVLWXDWHG
27KHFUHGLWRUVKDOOQRWHxercise the remedies specified in the preceding
paragraph without the prior consent in writing of the holder of any registered
LQWHUHVWUDQNLQJLQSULRULW\WRWKDWRIWKHFUHGLWRU
3$UWLFOH(3) RIWKH&RQYHQWLRQVKDOOQRWDSSO\WRDLUFUDIWREMHFWV$Q\
remedy given by the Convention in relation to an aircraft object shall be exercised
LQDFRPPHUFLDOO\UHDVRQDEOHPDQQHU$UHPHG\VKDOOEHGHHPHGWREHH[HUFLVHG
in a commercially reasonable manner where it is exercised in conformity with a
provision of the agreement except where such a provision is manifestly
XQUHDVRQDEOH
4. A chargee giving ten or more working days’ prior written notice of a
proposed sale or lease to interested persons shall be deemed to satisfy the
requirement of providing “reasonable prior notice” specified in Article 8(4) of the
&RQYHQWLRQ 7KH IRUHJRLQJ VKDOO QRW SUHYHQW D FKDUJHH DQG D FKDUJRU RU D
JXDUDQWRUIURPDJUHHLQJWRDORQJHUSHULRGRISULRUQRWLFH
57KHUHJLVWU\DXWKRULW\LQD&RQWUDFWLQJ6WDWHVKDOOVXEMHFWWRDQ\DSSOLFable
safety laws and regulations, honour a request for de-registration and export if:
(a) the request is properly submitted by the authorised party under a
recorded irrevocable de-registration and export request authorisation; and
(b) the authorised party certifies to the registry authority, if required
by that authority, that all registered interests ranking in priority to that of the
creditor in whose favour the authorisation has been issued have been
discharged or that the holders of such interests have consented to the
de-UHJLVWUDWLRQDQGH[SRUW
6 $ FKDUJHH SURSRVLQJ WR SURFXUH WKH GH-registration and export of an
aircraft under paragraph 1 otherwise than pursuant to a court order shall give
reasonable prior notice in writing of the proposed de-registration and export to:
34 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(a) interested persons specified in Article 1(m)(i) and (ii) of the
Convention; and
(b) interested persons specified in Article 1(m)(iii) of the Convention
who have given notice of their rights to the chargee within a reasonable time
prior to the de-UHJLVWUDWLRQDQGH[SRUW
$UWLFOH;
0RGLILFDWLRQRISURYLVLRQVUHJDUGLQJUHOLHISHQGLQJILQDO
determination
17KLV$UWLFOHDSSOLHVRQO\ZKHUHD Contracting State has made a declaration
under Article XXX(2DQGWRWKHH[WHQWVWDWHGLQVXFKGHFODUDWLRQ
2)RUWKHSXUSRVHVRI$UWLFOH(1) of the Convention, “speedy” in the
context of obtaining relief means within such number of working days from the
date of filing of the application for relief as is specified in a declaration made by
WKH&RQWUDFWLQJ6WDWHLQZKLFKWKHDSSOLFDWLRQLVPDGH
3$UWLFOH 1) of the Convention applies with the following being added
immediately after sub-paragraph (d): “(e) if at any time the debtor and the creditor
specifically agree, sale and application of proceeds therefrom”, and Article 43(2)
applies with the insertion after the words “Article 13(1)(d)” of the words “and (e)”.
42ZQHUVKLSRUDQ\RWKHULQWHUHVWRIWKHGHEWRUSDVVLQJRQDVDOHXQGHUWKH
preceding paragraph is free from any other interest over which the creditor’s
international interest has priority under the provisions of Article 29 of the
&RQYHQWLRQ
57KHFUHGLWRUDQGWKHGHEWRURUDQ\RWKHULQWHUHVWHGSHUVRQPD\DJUHHLQ
ZULWLQJWRH[FOXGHWKHDSSOLFDWLRQRI$UWLFOH(2) RIWKH&RQYHQWLRQ
6:LWKUHJDUGWRWKHUHPHGLHVLQ$UWLFOH,;(1):
(a) they shall be made available by the registry authority and other
administrative authorities, as applicable, in a Contracting State no later than
five working days after the creditor notifies such authorities that the relief
specified in Article IX(1) is granted or, in the case of relief granted by a
foreign court, recognised by a court of that Contracting State, and that the
creditor is entitled to procure those remedies in accordance with the
Convention; and
(b) the applicable authorities shall expeditiously co-operate with and
assist the creditor in the exercise of such remedies in conformity with the
DSSOLFDEOHDYLDWLRQVDIHW\ODZVDQGUHJXODWLRQV
73DUDJUDSKVDQGVKDOOQRWDIIHFWDQ\DSSOLFDEOHDYLDWLRQVDIHW\ODZV
DQGUHJXODWLRQV
$UWLFOH;,
RHPHGLHVRQLQVROYHQF\
17KLV$UWLFOHDSSOLHVRQO\ZKHUHD&RQWUDFWLQJ6WDWHWKDWLVWKHSULPDU\
insolvency jurisdiction has made a declaration pursuant to Article XXX(3)
Alternative A
2 8SRQ WKH RFFXUUHQFH RI DQ LQVROYHQF\-related event, the insolvency
administrator or the debtor, as applicable, shall, subject to paragraph 7, give
possession of the aircraft object to the creditor no later than the earlier of:
(a) the end of the waiting period; and
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 35
(b) the date on which the creditor would be entitled to possession of
WKHDLUFUDIWREMHFWLIWKLV$UWLFOHGLGQRWDSSO\
3. For the purposes of this Article, the “waiting period” shall be the period
specified in a declaration of the Contracting State which is the primary insolvency
MXULVGLFWLRQ
4. References in this Article to the “insolvency administrator” shall be to
WKDWSHUVRQLQLWVRIILFLDOQRWLQLWVSHUVRQDOFDSDFLW\
58QOHVVDQGXQWLOWKHFUHGLWRULVJLYHQWKHRSSRUWXQLW\WRWDNHSRVVHVVLRQ
under paragraph 2:
(a) the insolvency administrator or the debtor, as applicable, shall
preserve the aircraft object and maintain it and its value in accordance with
the agreement; and
(b) the creditor shall be entitled to apply for any other forms of interim
rHOLHIDYDLODEOHXQGHUWKHDSSOLFDEOHODZ
66XE-paragraph (a) of the preceding paragraph shall not preclude the use
of the aircraft object under arrangements designed to preserve the aircraft object
DQGPDLQWDLQLWDQGLWVYDOXH
7 7KH LQVROYHQF\ DGPLQLVtrator or the debtor, as applicable, may retain
possession of the aircraft object where, by the time specified in paragraph 2, it has
cured all defaults other than a default constituted by the opening of insolvency
proceedings and has agreed to perform all IXWXUHREOLJDWLRQVXQGHUWKHDJUHHPHQW
A second waiting period shall not apply in respect of a default in the performance
RIVXFKIXWXUHREOLJDWLRQV
8:LWKUHJDUGWRWKHUHPHGLHVLQ$UWLFOH,;(1):
(a) they shall be made available by the registry authority and the
administrative authorities in a Contracting State, as applicable, no later than
five working days after the date on which the creditor notifies such
authorities that it is entitled to procure those remedies in accordance with
the Convention; and
(b) the applicable authorities shall expeditiously co-operate with and
assist the creditor in the exercise of such remedies in conformity with the
DSSOLFDEOHDYLDWLRQVDIHW\ODZVDQGUHJXODWLRQV
91RH[HUFLVHRIUHPHGLHVSHUPLWWHGE\WKH&RQYHQWLRQRUthis Protocol may
EHSUHYHQWHGRUGHOD\HGDIWHUWKHGDWHVSHFLILHGLQSDUDJUDSK
10 1R REOLJDWLRQV RI WKH GHEWRU XQGHU WKH DJUHHPHQW PD\ EH PRGLILHG
ZLWKRXWWKHFRQVHQWRIWKHFUHGLWRU
11 1RWKLQJ LQ WKH SUHFHGLQJ SDUDJUDSK VKDOO EH FRQVWUXHG WR DIIHFW the
authority, if any, of the insolvency administrator under the applicable law to
WHUPLQDWHWKHDJUHHPHQW
121RULJKWVRULQWHUHVWVH[FHSWIRUQRQ-consensual rights or interests of a
FDWHJRU\FRYHUHGE\DGHFODUDWLRQSXUVXDQWWR$UWLFOH (1), shall have priority in
LQVROYHQF\SURFHHGLQJVRYHUUHJLVWHUHGLQWHUHVWV
137KH&RQYHQWLRQDVPRGLILHGE\$UWLFOH,;RIWKLV3URWRFROVKDOODSSO\
WRWKHH[HUFLVHRIDQ\UHPHGLHVXQGHUWKLV$UWLFOH
Alternative B
2 8SRQ WKH RFFXUUHQFH RI DQ LQVROYHQF\-related event, the insolvency
administrator or the debtor, as applicable, upon the request of the creditor, shall
give notice to the creditor within the time specified in a declaration of a
Contracting State pursuant to Article XXX(3) whether it will:
36 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(a) cure all defaults other than a default constituted by the opening of
insolvency proceedings and agree to perform all future obligations, under
the agreement and related transaction documents; or
(b) give the creditor the opportunity to take possession of the aircraft
REMHFWLQDFFRUGDQFHZLWKWKHDSSOLFDEOHODZ
3 7KH DSSOLFDEOH ODZ UHIHUUHG WR LQ VXE-paragraph (b) of the preceding
paragraph may permit the court to require the taking of any additional step or the
SURYLVLRQRIDQ\DGGLWLRQDOJXDUDQWHH
4 The creditor shall provide evidence of its claims and proof that its
LQWHUQDWLRQDOLQWHUHVWKDVEHHQUHJLVWHUHG
5,IWKHLQVROYHQF\DGPLQLVWUDWRURUWKHGHEWRUDVDSSOLFDEOHGRHVQRWJLYH
notice in conformity with paragraph 2, or when the insolvency administrator or
the debtor has declared that it will give the creditor the opportunity to take
possession of the aircraft object but fails to do so, the court may permit the creditor
to take possession of the aircraft object upon such terms as the court may order
and may require the taking of any additional step or the provision of any additional
JXDUDQWHH
67KHDLUFUDIWREMHFWVKDOOQRWEHVROGSHQGLQJDGHFLVLRQE\DFRXUWUHJDUGLQJ
WKHFODLPDQGWKHLQWHUQDWLRQDOLQWHUHVW
$UWLFOH;,,
,QVROYHQF\DVVLVWance
1 7KLV $UWLFOH DSSOLHV RQO\ ZKHUH D &RQWUDFWLQJ 6WDWH KDV PDGH D
declaration pursuant to Article XXX(1)
27KHFRXUWVRID&RQWUDFWLQJ6WDWHLQZKLFKDQDLUFUDIWREMHFWLVVLWXDWHG
shall, in accordance with the law of the Contracting State, co-operate to the
maximum extent possible with foreign courts and foreign insolvency
DGPLQLVWUDWRUVLQFDUU\LQJRXWWKHSURYLVLRQVRI$UWLFOH;,
$UWLFOH;,,,
De-registration and export request authorisation
17KLV$UWLFOHDSSOLHVRQO\ZKHUHD&RQWUDFWLQJ6WDWHKas made a declaration
pursuant to Article XXX(1
2:KHUHWKHGHEWRUKDVLVVXHGDQLUUHYRFDEOHGH-registration and export
request authorisation substantially in the form annexed to this Protocol and has
submitted such authorisation for recordation to the registry authority, that
DXWKRULVDWLRQVKDOOEHVRUHFRUGHG
3 7KH SHUVRQ LQ ZKRVH IDYRXU WKH DXWKRULVDWLRQ KDV EHHQ LVVXHG
(the “authorised party”) or its certified designee shall be the sole person entitled
to exercise the remedies specified in Article IX(1) and may do so only in
accordance with the authorisation and applicable aviation safety laws and
UHJXODWLRQV6XFKDXWKRULVDWLRQPD\QRWEHUHYRked by the debtor without the
FRQVHQWLQZULWLQJRIWKHDXWKRULVHGSDUW\7KHUHJLVWU\DXWKRULW\VKDOOUHPRYHDQ
DXWKRULVDWLRQIURPWKHUHJLVWU\DWWKHUHTXHVWRIWKHDXWKRULVHGSDUW\
47KHUHJLVWU\DXWKRULW\DQGRWKHUDGPLQLVWUDWLYHDXWKRULWLHVLQ&RQWUacting
States shall expeditiously co-operate with and assist the authorised party in the
H[HUFLVHRIWKHUHPHGLHVVSHFLILHGLQ$UWLFOH,;
$UWLFOH;,9
Modification of priority provisions
1$EX\HURIDQDLUFUDIWREMHFWXQGHUDUHJLVWHUHGVDOHDFTXLUHVLWV interest in
that object free from an interest subsequently registered and from an unregistered
LQWHUHVWHYHQLIWKHEX\HUKDVDFWXDONQRZOHGJHRIWKHXQUHJLVWHUHGLQWHUHVW
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 37
2$EX\HURIDQDLUFUDIWREMHFWDFTXLUHVLWVLQWHUHVWLQWKDWREMHFWsubject to
DQLQWHUHVWUHJLVWHUHGDWWKHWLPHRILWVDFTXLVLWLRQ
32ZQHUVKLSRIRUDQRWKHUULJKWRULQWHUHVWLQDQDLUFUDIWHQJLQHVKDOOQRWEH
DIIHFWHGE\LWVLQVWDOODWLRQRQRUUHPRYDOIURPDQDLUFUDIW
4$UWLFOH 29(7) of the Convention applies to an item, other than an object,
LQVWDOOHGRQDQDLUIUDPHDLUFUDIWHQJLQHRUKHOLFRSWHU
$UWLFOH;9
Modification of assignment provisions
$UWLFOH (1) of the Convention applies as if the following were added
immediately after sub-paragraph (b): “and (c) the debtor has consented in writing,
whether or not the consent is given in advance of the assignment or identifies the
assignee”
$UWLFOH;9,
Debtor provisions
1 ,Q WKH DEVHQFH RI D GHIDXOW ZLWKLQ WKH PHDQLQJ RI $UWLFOH RI WKH
Convention, the debtor shall be entitled to the quiet possession and use of the
object in accordance with the agreement as against:
(a) its creditor and the holder of any interest from which the debtor
takes free pursuant to Article 29(4) of the Convention or, in the capacity of
buyer, Article XIV(1) of this Protocol, unless and to the extent that the
debtor has otherwise agreed; and
(b) the holder of any interest to which the debtor’s right or interest is
subject pursuant to Article 29(4) of the Convention or, in the capacity of
buyer, Article XIV(2) of this Protocol, but only to the extent, if any, that
VXFKKROGHUKDVDJUHHG
2 1RWKLQJ LQ WKH &RQYHQWLRQ RU WKLV 3URWRFRO DIIHcts the liability of a
creditor for any breach of the agreement under the applicable law in so far as that
DJUHHPHQWUHODWHVWRDQDLUFUDIWREMHFW
CHAPTER III
Registry provisions relating to international interests in aircraft objects
$UWLFOH;9,,
The Supervisory Authority and the Registrar
17KH6XSHUYLVRU\$XWKRULW\VKDOOEHWKHLQWHUQDWLRQDOHQWLW\GHVLJQDWHGE\
a Resolution adopted by the Diplomatic Conference to Adopt a Mobile Equipment
&RQYHQWLRQDQGDQ$LUFUDIW3URWRFRO
2:KHUHWKHLQWHUQDWLRQal entity referred to in the preceding paragraph is
not able and willing to act as Supervisory Authority, a Conference of Signatory
and Contracting States shall be convened to designate another Supervisory
$XWKRULW\
37KH6XSHUYLVRU\$XWKRULW\DQGLWVRIficers and employees shall enjoy
such immunity from legal and administrative process as is provided under the
UXOHVDSSOLFDEOHWRWKHPDVDQLQWHUQDWLRQDOHQWLW\RURWKHUZLVH
47KH6XSHUYLVRU\$XWKRULW\PD\HVWDEOLVKDFRPPLVVLRQRIH[SHUWVIURP
among persons nominated by Signatory and Contracting States and having the
necessary qualifications and experience, and entrust it with the task of assisting
WKH6XSHUYLVRU\$XWKRULW\LQWKHGLVFKDUJHRILWVIXQFWLRQV
38 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
57KHILUVW5HJLVWUDUVKDOOoperate the International Registry for a period of
ILYH \HDUV IURP WKH GDWH RI HQWU\ LQWR IRUFH RI WKLV 3URWRFRO 7KHUHDIWHU WKH
Registrar shall be appointed or reappointed at regular five-yearly intervals by the
6XSHUYLVRU\$XWKRULW\
$UWLFOH;9,,,
First UHJXODWLRQV
The first regulations shall be made by the Supervisory Authority so as to
WDNHHIIHFWXSRQWKHHQWU\LQWRIRUFHRIWKLV3URWRFRO
$UWLFOH;,;
Designated entry points
16XEMHFWWRSDUDJUDSKD&RQWUDFWLQJ6WDWHPD\DWDQ\WLPHGHVLJQDWHDQ
entity or entities in its territory as the entry point or entry points through which
there shall or may be transmitted to the International Registry information
required for registration other than registration of a notice of a national interest or
a right or interest under Article 40 in either case arising under the laws of another
6WDWH
2$GHVLJQDWLRQPDGHXQGHUWKHSUHFHGLQJSDUDJUDSKPD\SHUPLWEXWQRW
compel, use of a designated entry point or entry points for information required
for registrations LQUHVSHFWRIDLUFUDIWHQJLQHV
$UWLFOH;;
$GGLWLRQDOPRGLILFDWLRQVWR5HJLVWU\SURYLVLRQV
1)RUWKHSXUSRVHVRI$UWLFOH (6) of the Convention, the search criteria
for an aircraft object shall be the name of its manufacturer, its manufacturer’s
serial number and its model designation, supplemented as necessary to ensure
XQLTXHQHVV6XFKVXSSOHPHQWDU\LQIRUPDWLRQVKDOOEHVSHFLILHGLQWKHUHJXODWLRQV
2 )RU WKH SXUSRVHV RI $UWLFOH (2) of the Convention and in the
circumstances there described, the holder of a registered prospective international
interest or a registered prospective assignment of an international interest or the
person in whose favour a prospective sale has been registered shall take such steps
as are within its power to procure the discharge of the registration no later than
ILYHZRUNLQJGD\VDIWHUWKHUHFHLSWRIWKHGHPDQGGHVFULEHGLQVXFKSDUDJUDSK
3 7KH Iees referred to in Article 17(2)(h) of the Convention shall be
determined so as to recover the reasonable costs of establishing, operating and
regulating the International Registry and the reasonable costs of the Supervisory
Authority associated with the performance of the functions, exercise of the
powers, and discharge of the duties contemplated by Article 17(2) of the
&RQYHQWLRQ
47KHFHQWUDOLVHGIXQFWLRQVRIWKH,QWHUQDWLRQDO5HJLVWU\VKDOOEHRSHUDWHG
and administered by the Registrar on a twenty-fouUKRXUEDVLV7KHYDULRXVHQWU\
points shall be operated at least during working hours in their respective
WHUULWRULHV
5 7KH DPRXQW RI WKH LQVXUDQFH RU ILQDQFLDO JXDUDQWHH UHIHUUHG WR LQ
Article 28(4) of the Convention shall, in respect of each event, not be less than the
PD[LPXPYDOXHRIDQDLUFUDIWREMHFWDVGHWHUPLQHGE\WKH6XSHUYLVRU\$XWKRULW\
61RWKLQJLQWKH&RQYHQWLRQVKDOOSUHFOXGHWKH5HJLVWUDUIURPSURFXULQJ
insurance or a financial guarantee covering events for which the Registrar is not
OLDEOHXQGHU$UWLFOHRIWKH&RQYHQWLRQ
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 39
&+$37(5,9
Jurisdiction
$UWLFOH;;,
0RGLILFDWLRQRIMXULVGLFWLRQSURYLVLRQV
)RUWKHSXUSRVHVRI$UWLFOHRIWKH&RQYHQWLRQDQGVXEMHFWWR$UWLFOH
of the Convention, a court of a Contracting State also has jurisdiction where the
object is a helicopter, or an airframe pertaining to an aircraft, for which that State
LVWKH6WDWHRIUHJLVWU\
$UWLFOH;;,,
Waivers of sovereign immunity
16XEMHFWWRSDUDJUDSKDZDLYHURIsovereign immunity from jurisdiction
RIWKHFRXUWVVSHFLILHGLQ$UWLFOHRU$UWLFOHRIWKH&RQYHQWLRQRUUHODWLQJWR
enforcement of rights and interests relating to an aircraft object under the
Convention shall be binding and, if the other conditions to such jurisdiction or
enforcement have been satisfied, shall be effective to confer jurisdiction and
SHUPLWHQIRUFHPHQWDVWKHFDVHPD\EH
2$ZDLYHUXQGHUWKHSUHFHGLQJSDUDJUDSKPXVWEHLQZULWLQJDQGFRQWDLQD
GHVFULSWLRQRIWKHDLUFUDIWREMHFW
CH$37(59
Relationship with other conventions
$UWLFOH;;,,,
5HODWLRQVKLSZLWKWKH&RQYHQWLRQRQWKH,QWHUQDWLRQDO5HFRJQLWLRQRI
Rights in Aircraft
The Convention shall, for a Contracting State that is a party to the
Convention on the International Recognition of Rights in Aircraft, signed at
Geneva on 19 June 1948, supersede that Convention as it relates to aircraft, as
GHILQHGLQWKLV3URWRFRODQGWRDLUFUDIWREMHFWV+RZHYHUZLWKUHVSHFWWRULJKWVRU
interests not covered or affected by the present Convention, the Geneva
&RQYHQWLRQVKDOOQRWEHVXSHUVHGHG
$UWLFOH;;,9
5HODWLRQVKLSZLWKWKH&RQYHQWLRQIRUWKH8QLILFDWLRQRI&HUWDLQ5XOHV
5HODWLQJWRWKH3UHFDXWLRQDU\$WWDFKPHQWRI$LUFUDIW
1 7KH &RQYHQWLRQ VKDOO IRU D &RQWUDFWLQJ 6WDWH WKDW LV D 3DUW\ Wo the
Convention for the Unification of Certain Rules Relating to the Precautionary
$WWDFKPHQW RI $LUFUDIW VLJQHG DW 5RPH RQ 0D\ VXSHUVHGH WKDW
&RQYHQWLRQDVLWUHODWHVWRDLUFUDIWDVGHILQHGLQWKLV3URWRFRO
2$&RQWUDFWLQJ6WDWH3DUW\WRWKH above Convention may declare, at the
time of ratification, acceptance, approval of, or accession to this Protocol, that it
ZLOOQRWDSSO\WKLV$UWLFOH
$UWLFOH;;9
5HODWLRQVKLSZLWKWKH81,'52,7&RQYHQWLRQRQ,QWHUQDWLRQDO
)LQDQFLDO/HDVLQJ
The Convention shall supersede the UNIDROIT Convention on International
Financial Leasing, signed at Ottawa on 28 May 1988, as it relates to aircraft
REMHFWV
40 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
&+$37(59,
Final provisions
$UWLFOH;;9,
6LJQDWXUHUDWLILFDWLRQDFFHSWDQFHDSSURYDORUaccession
1 7KLV 3URWRFRO VKDOO EH RSHQ IRU VLJQDWXUH LQ &DSH 7RZQ RQ
16 November 2001 by States participating in the Diplomatic Conference to Adopt
a Mobile Equipment Convention and an Aircraft Protocol held at Cape Town from
2FWREHUWR1RYHPEHU$IWHU1RYHPEHUWKLV3URWRFROVKDOO
be open to all States for signature at the Headquarters of the International Institute
for the Unification of Private Law (UNIDROIT) in Rome until it enters into force
in accordancHZLWK$UWLFOH;;9,,,
27KLV3URWRFROVKDOOEHVXEMHFWWRUDWLILFDWLRQDFFHSWDQFHRUDSSURYDOE\
6WDWHVZKLFKKDYHVLJQHGLW
3$Q\6WDWHZKLFKGRHVQRWVLJQWKLV3URWRFROPD\DFFHGHWRLWDWDQ\WLPH
45DWLILFDWLRQDFFHSWDQFHDSSURYDORUDFFHVVLRQ is effected by the deposit
RIDIRUPDOLQVWUXPHQWWRWKDWHIIHFWZLWKWKH'HSRVLWDU\
5$6WDWHPD\QRWEHFRPHD3DUW\WRWKLV3URWRFROXQOHVVLWLVRUEHFRPHV
DOVRD3DUW\WRWKH&RQYHQWLRQ
$UWLFOH;;9,,
5HJLRQDO(FRQRPLF,QWHJUDWLRQ2UJDQLVDWLRQV
1$ Regional Economic Integration Organisation which is constituted by
sovereign States and has competence over certain matters governed by this
3URWRFRO PD\ VLPLODUO\ VLJQ DFFHSW DSSURYH RU DFFHGH WR WKLV 3URWRFRO 7KH
Regional Economic Integration Organisation shall in that case have the rights and
obligations of a Contracting State, to the extent that that Organisation has
FRPSHWHQFH RYHU PDWWHUV JRYHUQHG E\ WKLV 3URWRFRO :KHUH WKH QXPEHU RI
Contracting States is relevant in this Protocol, the Regional Economic Integration
Organisation shall not count as a Contracting State in addition to its Member
6WDWHVZKLFKDUH&RQWUDFWLQJ6WDWHV
27KH5HJLRQDO(FRQRPLF,QWHJUDWLRQ2UJDQLVDWLRQVKDOODWWKHWLPHRI
signature, acceptance, approval or accession, make a declaration to the Depositary
specifying the matters governed by this Protocol in respect of which competence
KDVEHHQWUDQVIHUUHGWRWKDW2UJDQLVDWLRQE\LWV0HPEHU6WDWHV7KH5HJLRQDO
Economic Integration Organisation shall promptly notify the Depositary of any
changes to the distribution of competence, including new transfers of competence,
VSHFLILHGLQWKHGHFODUDWLRQXQGHUWKLVSDUDJUDSK
3. Any reference to a “Contracting State” or “Contracting States” or “State
Party” or “States Parties” in this Protocol applies equally to a Regional Economic
,QWHJUDWLRQ2UJDQLVDWLRQZKHUHWKHFRQWH[WVRUHTXLUHV
$UWLFOH;;9,,,
Entry into force
17KLV3URWRFROHQWHUVLQWRIRUFHRQWKHILUVWGD\RIWKHPRQWKIROORZLQJWKH
expiration of three months after the date of the deposit of the eighth instrument of
ratification, acceptance, approval or accession, between the States which have
GHSRVLWHGVXFKLQVWUXPHQWV
2)RURWKHU6WDWHVWKLV3URWRFROHQWHUVLQWRIRUFHRQWKHILUVWGD\RIWKH
month following the expiration of three months after the date of the deposit of its
LQVWUXPHQWRIUDWLILFDWLRQDFFHSWDQFHDSSURYDORUDFFHVVLRQ
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 41
$UWLFOH;;,;
7HUULWRULDOXQLWV
1,ID&RQWUDFWLQJ6WDWHKDVWHUULWRULDOXQLWVLQZKLFKGLIIHUHQWV\VWHPVRI
law are applicable in relation to the matters dealt with in this Protocol, it may, at
the time of ratification, acceptance, approval or accession, declare that this
Protocol is to extend to all its territorial units or only to one or more of them and
may modify itVGHFODUDWLRQE\VXEPLWWLQJDQRWKHUGHFODUDWLRQDWDQ\WLPH
2$Q\VXFKGHFODUDWLRQVKDOOVWDWHH[SUHVVO\WKHWHUULWRULDOXQLWVWRZKLFK
WKLV3URWRFRODSSOLHV
3,ID&RQWUDFWLQJ6WDWHKDVQRWPDGHDQ\GHFODUDWLRQXQGHUSDUDJUDSK
this Protocol shall aSSO\WRDOOWHUULWRULDOXQLWVRIWKDW6WDWH
4:KHUHD&RQWUDFWLQJ6WDWHH[WHQGVWKLV3URWRFROWRRQHRUPRUHRILWV
territorial units, declarations permitted under this Protocol may be made in respect
of each such territorial unit, and the declarations made in respect of one territorial
XQLWPD\EHGLIIHUHQWIURPWKRVHPDGHLQUHVSHFWRIDQRWKHUWHUULWRULDOXQLW
5,IE\YLUWXHRIDGHFODUDWLRQXQGHUSDUDJUDSKWKLV3URWRFROH[WHQGVWR
one or more territorial units of a Contracting State:
(a) the debtor is considered to be situated in a Contracting State only
if it is incorporated or formed under a law in force in a territorial unit to
which the Convention and this Protocol apply or if it has its registered office
or statutory seat, centre of administration, place of business or habitual
residence in a territorial unit to which the Convention and this Protocol
apply;
(b) any reference to the location of the object in a Contracting State
refers to the location of the object in a territorial unit to which the Convention
and this Protocol apply; and
(c) any reference to the administrative authorities in that Contracting
State shall be construed as referring to the administrative authorities having
jurisdiction in a territorial unit to which the Convention and this Protocol
apply and any reference to the national register or to the registry authority
in that Contracting State shall be construed as referring to the aircraft
register in force or to the registry authority having jurisdiction in the
terrLWRULDOXQLWRUXQLWVWRZKLFKWKH&RQYHQWLRQDQGWKLV3URWRFRODSSO\
$UWLFOH;;;
'HFODUDWLRQVUHODWLQJWRFHUWDLQSURYLVLRQV
1$&RQWUDFWLQJ6WDWHPD\DWWKHWLPHRIUDWLILFDWLRQDFFHSWDQFHDSSURYDO
of, or accession to this Protocol, declare that it will apply any one or more of
$UWLFOHV9,,,;,,DQG;,,,RIWKLV3URWRFRO
2$&RQWUDFWLQJ6WDWHPD\DWWKHWLPHRIUDWLILFDWLRQDFFHSWDQFHDSSURYDO
of, or accession to this Protocol, declare that it will apply Article X of this
Protocol, wholly or in SDUW,ILWVRGHFODUHVZLWKUHVSHFWWR$UWLFOH;(2), it shall
specify the time-SHULRGUHTXLUHGWKHUHE\
3$&RQWUDFWLQJ6WDWHPD\DWWKHWLPHRIUDWLILFDWLRQDFFHSWDQFHDSSURYDO
of, or accession to this Protocol, declare that it will apply the entirety of Alternative
A, or the entirety of Alternative B of Article XI and, if so, shall specify the types of
insolvency proceeding, if any, to which it will apply Alternative A and the types of
insolvency proceeding, if any, to which it will apply AlternativH%$&RQWUDFWLQJ
State making a declaration pursuant to this paragraph shall specify the time-period
UHTXLUHGE\$UWLFOH;,
42 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
47KHFRXUWVRI&RQWUDFWLQJ6WDWHVVKDOODSSO\$UWLFOH;,LQFRQIRUPLW\ZLWK
the declaration made by the Contracting State which is the primary insolvency
MXULVGLFWLRQ
5$&RQWUDFWLQJ6WDWHPD\DWWKHWLPHRIUDWLILFDWLRQDFFHSWDQFHDSSURYDO
of, or accession to this Protocol, declare that it will not apply the provisions of
Article XXI, wholly or in part 7KH GHFODUDWLRQ VKDOO VSHFLI\ XQGHU ZKLFK
conditions the relevant Article will be applied, in case it will be applied partly, or
RWKHUZLVHZKLFKRWKHUIRUPVRILQWHULPUHOLHIZLOOEHDSSOLHG
$UWLFOH;;;,
'HFODUDWLRQVXQGHUWKH&RQYHQWLRQ
Declarations made under the Convention, including those made under
$UWLFOHV DQGRIWKH&RQYHQWLRQVKDOOEHGHHPHG
WRKDYHDOVREHHQPDGHXQGHUWKLV3URWRFROXQOHVVVWDWHGRWKHUZLVH
$UWLFOH;;;,,
Reservations and GHFODUDWLRQV
11RUHVHUYDWLRQVPD\EHPDGHWRWKLV3URWRFROEXWGHFODUDWLRQVDXWKRULVHG
by Articles XXIV, XXIX, XXX, XXXI, XXXIII and XXXIV may be made in
DFFRUGDQFHZLWKWKHVHSURYLVLRQV
2$Q\GHFODUDWLRQRUVXEVHTXHQWGHFODUDWLRQRUDQ\ZLWKGUDZDORIa declaration
PDGHXQGHUWKLV3URWRFROVKDOOEHQRWLILHGLQZULWLQJWRWKH'HSRVLWDU\
$UWLFOH;;;,,,
6XEVHTXHQWGHFODUDWLRQV
1$6WDWH3DUW\PD\PDNHDVXEVHTXHQWGHFODUDWLRQRWKHUWKDQDGHFODUDWLRQ
made in accordance with Article XXXI under Article 60 of the Convention, at any
time after the date on which this Protocol has entered into force for it, by notifying
WKH'HSRVLWDU\WRWKDWHIIHFW
2$Q\VXFKVXEVHTXHQWGHFODUDWLRQVKDOOWDNHHIIHFWRQWKHILUVWGD\RIWKH
month following the expiration of six months after the date of receipt of the
QRWLILFDWLRQE\WKH'HSRVLWDU\:KHUHDORQJHUSHULRGIRUWKDWGHFODUDWLRQWRWDNH
effect is specified in the notification, it shall take effect upon the expiration of
such longer period after receipt of the notiILFDWLRQE\WKH'HSRVLWDU\
31RWZLWKVWDQGLQJWKHSUHYLRXVSDUDJUDSKVWKLV3URWRFROVKDOOFRQWLQXHWR
apply, as if no such subsequent declarations had been made, in respect of all rights
and interests arising prior to the effective date of any such subseTXHQWGHFODUDWLRQ
$UWLFOH;;;,9
:LWKGUDZDORIGHFODUDWLRQ
1$Q\6WDWH3DUW\KDYLQJPDGHDGHFODUDWLRQXQGHUWKLV3URWRFRORWKHUWKDQ
a declaration made in accordance with Article XXXI under Article 60 of the
Convention, may withdraw it at any time by noWLI\LQJ WKH 'HSRVLWDU\ 6XFK
withdrawal is to take effect on the first day of the month following the expiration
RIVL[PRQWKVDIWHUWKHGDWHRIUHFHLSWRIWKHQRWLILFDWLRQE\WKH'HSRVLWDU\
21RWZLWKVWDQGLQJWKHSUHYLRXVSDUDJUDSKWKLV3URWRFROVKDOOFontinue to
apply, as if no such withdrawal of declaration had been made, in respect of all
ULJKWVDQGLQWHUHVWVDULVLQJSULRUWRWKHHIIHFWLYHGDWHRIDQ\VXFKZLWKGUDZDO
$UWLFOH;;;9
Denunciations
1$Q\6WDWH3DUW\PD\GHQRXQFHWKLV3URWRFROE\QRWLILFDtion in writing to
WKH'HSRVLWDU\
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 43
2 $Q\VXFKGHQXQFLDWLRQVKDOOWDNHHIIHFWRQWKHILUVWGD\RIWKHPRQWK
following the expiration of twelve months after the date of receipt of the
QRWLILFDWLRQE\WKH'HSRVLWDU\
3 1RWZLWKVWDQGLQJWKHprevious paragraphs, this Protocol shall continue to
apply, as if no such denunciation had been made, in respect of all rights and
LQWHUHVWVDULVLQJSULRUWRWKHHIIHFWLYHGDWHRIDQ\VXFKGHQXQFLDWLRQ
$UWLFOH;;;9,
5HYLHZ&RQIHUHQFHVDPHQGPHQWVDQGUHODWHGPDWWHUV
1 7KH 'HSRVLWDU\ LQ FRQVXOWDWLRQ ZLWK WKH 6XSHUYLVRU\ $XWKRULW\ VKDOO
prepare reports yearly, or at such other time as the circumstances may require, for
the States Parties as to the manner in which the international regime established
LQ WKH &RQYHQWLRQ DV DPHQGHG E\ WKLV 3URWRFRO KDV RSHUDWHG LQ SUDFWLFH ,Q
preparing such reports, the Depositary shall take into account the reports of the
Supervisory Authority concerning the functioning of the international registration
syVWHP
2 $WWKHUHTXHVWRIQRWOHVVWKDQWZHQW\-five per cent of the States Parties,
Review Conferences of the States Parties shall be convened from time to time by
the Depositary, in consultation with the Supervisory Authority, to consider:
(a) the practical operation of the Convention as amended by this
Protocol and its effectiveness in facilitating the asset-based financing and
leasing of the objects covered by its terms;
(b) the judicial interpretation given to, and the application made of the
terms of this Protocol and the regulations;
(c) the functioning of the international registration system, the
performance of the Registrar and its oversight by the Supervisory Authority,
taking into account the reports of the Supervisory Authority; and
(d) whether any modifications to this Protocol or the arrangements
UHODWLQJWRWKH,QWHUQDWLRQDO5HJLVWU\DUHGHVLUDEOH
3 $Q\DPHQGPHQWWRWKLV3URWRFROVKDOOEHDSSURYHGE\DWOHDVWDWZR-thirds
majority of States Parties participating in the Conference referred to in the
preceding paragraph and shall then enter into force in respect of States which have
ratified, accepted or approved such amendment when it has been ratified, accepted
or approved by eight States in accordance with the provisions of Article XXVIII
rHODWLQJWRLWVHQWU\LQWRIRUFH
$UWLFOH;;;9,,
Depositary and its functions
1 ,QVWUXPHQWVRIUDWLILFDWLRQDFFHSWDQFHDSSURYDORUDFFHVVLRQVKDOOEH
deposited with the International Institute for the Unification of Private Law
(UNIDROIT), which is hereb\GHVLJQDWHGWKH'HSRVLWDU\
2 7KH'HSRVLWDU\VKDOO
(a) inform all Contracting States of:
(i) each new signature or deposit of an instrument of ratification,
acceptance, approval or accession, together with the date thereof;
(ii) the date of entry into force of this Protocol;
(iii) each declaration made in accordance with this Protocol,
together with the date thereof; and
44 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-18
(iv) the withdrawal or amendment of any declaration, together
with the date thereof;
(v) the notification of any denunciation of this Protocol together
with the date thereof and the date on which it takes effect;
(b) transmit certified true copies of this Protocol to all Contracting
States;
(c) provide the Supervisory Authority and the Registrar with a copy of
each instrument of ratification, acceptance, approval or accession, together
with the date of deposit thereof, of each declaration or withdrawal or
amendment of a declaration and of each notification of denunciation,
together with the date of notification thereof, so that the information
contained therein is easily and fully available; and
(d) perform such other IXQFWLRQVFXVWRPDU\IRUGHSRVLWDULHV
'55$-,90$1,
Secretary to the Govt. of India.
CORRIGENDUM
In the Waqf (Amendment) Act, 2025 (14 of 2025), as
published in the Gazette of India, Extraordinary, Part II, Section 1, dated
WKHWK$SULO,VVXH1RDWSDJH OLQHfor “substituted”, read
³LQVHUWHG´
———
Sd/-
No. 11-18] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 45
MINISTRY OF LAW AND JUSTICE
/HJLVODWLYH'HSDUWPHQW
New Delhi, the 18th August, 2025/Shravana 27, 1947 (Saka)
The following Act of Parliament received the assent of the President on the
18th August, 2025 and is hereby published for general information:—
THE MERCHANT SHIPPING ACT, 2025
1ඈඈൿ
[18th August@
An Act to consolidate and amend the law relating to merchant shipping to
ensure compliance with India’s obligation under the maritime treaties
and international instruments to which India is a party and also to
HQVXUHWKHGHYHORSPHQWRI,QGLDQVKLSSLQJDQGH൶FLHQWPDLQWHQDQFHRI
Indian mercantile marine in a manner best suited to serve the national
LQWHUHVWDQGIRUPDWWHUVFRQQHFWHGWKHUHZLWKRULQFLGHQWDOWKHUHWR
BE it enacted by Parliament in the Seventy-VL[WK Year of the Republic
of India as follows:—
PART I
PRELIMINARY
1. (1) This Act may be called the Merchant Shipping Act, 202
(2) It shall come into force on such date as the Central Government may, by
notification in the Official Gazette, appoint, and different dates may be appointed
IRUGLIIHUHQWSURYLVLRQVRIWKLV$FW
Short title and
FRPPHQFHPHQW
EXTRAORDINARY
REGD NO. JK–33
———————————————————————————————
Vol. 139 Srinagar, Thu., the 11th June, 2026/21st Jyai., 1948. [No. 11-25
———————————————————————————————
PART IV
Reprints from the Government of India Gazette.
———
pplication
f Act.
Definitions.
2. (1) Save as otherwise provided, the provisions of this Act shall apply
to,—
(a) any vessel which is registered in India; or
(b) any vessel which is required by this Act to be so registered,
wherever it may be.
(2) Save as otherwise provided, the provisions of this Act which apply to
vessels other than those referred to in sub-section (1) shall so apply only while
any such vessel is within India or its coastal waters.
(3) Subject to sub-section (2) and unless otherwise expressly provided, the
provisions of this Act shall not apply to Indian controlled tonnage vessels.
Explanation.—For the purposes of this sub-section, the expression “Indian
controlled tonnage vessel” means an Indian vessel, other than a fishing vessel or
sailing vessel, owned by any person specified under sub-section (1) of section 15
and registered at a port or place in a country other than India.
3. In this Act, unless the context otherwise requires,—
(1) “abandoned seafarer” means a seafarer who is deemed to have been
abandoned in violation of the provisions of this Act or the rules made
thereunder or the seafarers’ employment agreement, where the ship owner—
(a) fails to cover the cost of the seafarer’s repatriation; or
(b) has left the seafarer without the necessary maintenance and
support; or
(c) has otherwise unilaterally severed ties with the seafarer including
failure to pay contractual wages for a period of at least two months;
(2) “abandoned vessel” includes any of the following, namely:—
(a) a vessel which is abandoned by the ship owner without any
hope of recovering it or without any intention of returning to it; or
(b) a vessel whose master has no financial means for its
operation; or
(c) a vessel whose owner is unknown or cannot be traced within
reasonable time, despite the Central Government duly notifying the
flag State of the vessel or consulate of the country of domicile of the
registered owner or the master; or
(d) a vessel whose owner fails to fulfil the ship owner’s
obligations under this Act towards ensuring safety, security, prevention
of pollution or welfare of seafarers and whose insurer, salvor or
contractor fail to fulfil such obligations within such reasonable time as
may be specified by the Central Government; or
(e) a vessel restrained by any court or public authority in India
in respect of which the public authority or the person assigned
responsibility by the court to fulfil the ship owner’s obligations under
this Act towards ensuring safety, security, prevention of pollution or
welfare of seafarers, fails to do so.
Explanation.—For the purposes of sub-clause (d), failure on part of
the ship owner shall also include failure on part of the charterer, manager or
operator of the vessel;
(3) “agent”, in relation to a vessel, means a person authorised to act as
such by the owner and if such vessel is in port, the agent shall also have
authorisation from the port;
2 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
80 of 1976.
80 of 1976.
18 of 2013.
(4) “Anti-Fouling Systems Convention” means the International
Convention on Control of Harmful Anti-fouling Systems on Ships, 2001,
signed in London on 5th day of October, 2001;
(5) “audit” means a systematic and independent examination to
determine whether the management system as provided in the Safety
Convention complies with the planned arrangements and such arrangements
are implemented effectively and are sufficient to achieve the objectives of
the said convention;
(6) “Ballast Water Management Convention” means the International
Convention for the Control and Management of Ships’ Ballast Water and
Sediments, 2004, signed in London on the 13th day of February, 2004;
(7) “baseline” means the baseline referred to in sub-section (2) of
section 3 of the Territorial Waters, Continental Shelf, Exclusive Economic
Zone and Other Maritime Zones Act, 1976;
(8) “certificate of competency” or “certificate of proficiency” means
the certificate of competency or certificate of proficiency granted under
sub-section (1) of section 46;
(9) “chief ship surveyor” means the chief ship surveyor specified in
sub-clause (iii) of clause (d) of sub-section (1) of section 8;
(10)
“chief surveyor” means the chief surveyor specified in
sub-clause (ii) of clause (d) of sub-section (1) of section 8;
(11) “Civil Liability Convention” means the International Convention
on Civil Liability for Oil Pollution Damage, 1992;
(12) “coastal waters” means any part of territorial waters of India,
along with any part of the adjoining maritime zones of India within the
meaning of the Terriorial Waters, Continental Shelf, Exclusive Economic
Zone and Other Maritime Zones Act, 1976, or any other law for time being
in force;
(13) “coasts” include the coasts of creeks and any part of the sea or
any part of a river within the ebb and flow of the tide at ordinary spring
tides and not being a harbour (tidal waters);
(14) “company” means a company as defined in clause (20) of section 2
of the Companies Act, 2013;
(15) “convention” means an international convention to which India is
a party;
(16) “Director-General” means the Director-General of Maritime
Administration appointed under sub-section (1) of section 7;
(17) “equipment”, in relation to a vessel, includes boats, tackle,
machinery, boilers, cargo handling gear, pumps and any fitting, anchor,
propeller, apparels, furniture, life-saving appliances of every description,
spars, masts, rigging and sails, fog signals, lights, shapes and signals of
distress, medicines and medical and surgical stores and appliances, charts,
radio installations, appliances for preventing, detecting or extinguishing
fires, buckets, compasses, axes, lanterns, loading and discharging gears and
appliances of all kinds and all other stores and spares or articles belonging
to or to be used in connection with or necessary for the navigation,
propulsion, security, pollution prevention and safety of the vessel;
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 3
(18) “fisher” means any person engaged in any capacity or performing
any work aboard a fishing vessel at sea, by whatever means they are paid,
but not including pilots or persons in service of the Central Government or
the State Government aboard a fishing vessel, or any person who only
works aboard such vessel when onshore;
(19) “fishing vessel” means a vessel which is used or intended to be
used for the purpose of fishing in the seas;
(20) “gross tonnage” means the gross tonnage referred to in clause (b)
of sub-section (5) of section 20;
(21) “High Court”, in relation to a vessel, means a High Court within
the limits of whose jurisdiction,—
(a) the port of registry of the vessel is situate; or
(b) the vessel is for the time being; or
(c) the cause of action, wholly or in part, arises;
(22) “Indian ambassador” means the ambassador, high commissioner,
deputy ambassador, deputy high commissioner, consul-general, consul,
vice-consul, consular agent or pro consul appointed as such by the Central
Government and includes any person authorised by the Central Government
to perform the functions of an Indian ambassador;
(23) “Indian Coast Guard” means the Coast Guard constituted under
the Coast Guard Act, 1978;
(24) “Indian vessel” means a vessel which is registered under
section 15;
(25) “Limitation of Liability for Maritime Claims Convention” means
the Convention on Limitation of Liability for Maritime Claims signed in
London on the 19th day of November, 1976;
(26) “Maritime Labour Convention” means the Maritime Labour
Convention signed in Geneva on the 23rd day of February, 2006;
(27) “MARPOL Convention” means the International Convention for
the Prevention of Pollution from Ships, 1973 including its Protocol of 1978;
(28) “master” includes any person (except a pilot or a harbour master)
having command or charge of a vessel;
(29) “mortgage” means the transfer of an interest in a registered vessel
or a share therein for the purpose of securing the payment of money
advanced or to be advanced by way of loan, or other valuable consideration,
and the instrument creating the security, an existing or future debt, or the
performance of an agreement which may give rise to a pecuniary liability;
(30) “nautical advisor” means the nautical advisor specified in
sub-clause (i) of clause (d) of sub-section (1) of section 8;
(31) “notification” means a notification published in the Official
Gazette and the term “notify” or “notified” shall be construed accordingly;
(32) “owner”, in relation to a vessel, means the person to whom the
vessel or a share in the vessel belongs;
(33) “passenger” means any person carried onboard a vessel, except—
(a) a person employed or engaged in any capacity onboard the
vessel on the business of the vessel;
0 of 1978.
4 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
1 of 2021
(b) a person onboard the vessel either in pursuance of the
obligations laid upon the master to carry shipwrecked, distressed or other
persons or by reason of any circumstances which neither the master nor
the charterer, if any, could have prevented or forestalled; and
(c) a child under one year of age;
(34) “passenger vessel” means a vessel carrying more than twelve
passengers;
(35) “pollution damage” means,—
(a) loss or damage caused outside the vessel resulting from the
escape, emission or discharge of cargo, oil or any other material from
the vessel, wherever such escape, emission or discharge may occur; or
(b) the costs of impairment of environment or costs of
preventive measures and further loss or damage caused by preventive
measures;
(36) “pollution prevention convention” means any convention relating
to prevention of pollution from vessels, to which India is a party, including
MARPOL Convention, Anti-Fouling Systems Convention and Ballast Water
Management Convention;
(37) “port” shall include port facility, shipyard, ship breaking yards,
ship repair unit, offshore facilities and terminals;
(38) “port authority”,—
(a) in relation to any major port, means the Board of Major Port
Authority constituted under section 3 of the Major Port Authorities
Act, 2021;
(b) in relation to any other port, means such person or body of
persons responsible for the administration of ports under any other
applicable law;
(c) in relation to any terminal or place not forming a part of a
port, means the person under whose supervision the terminal or place
is operated;
(39) “port facility” means any location or area including anchorages
or awaiting berths or approaches from seaward as determined by the Central
Government, or such designated authority as the Central Government may
notify, where interface between vessels or a vessel and a port takes place;
(40) “port of registry” means the port or place notified as such under
sub-section (3) of section 15 and in relation to a vessel, sailing vessel,
fishing vessel or any other vessel, means the port at which such vessel is
registered;
(41) “prescribed” means prescribed by rules made by the Central
Government under this Act;
(42) “principal officer” means the principal officer appointed under
sub-section (2) of section 11;
(43) “proceeding” includes any suit, appeal or application under this
Act;
(44) “proper officer” means the officer designated by the Central
Government to be the proper officer at the port or place and in respect of
the matters to which reference is made in this Act;
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 5
(45) “proper return port” means such port as is agreed upon by the
seafarer and his employer, in the agreement or otherwise, or in the absence of
an agreement, the port where the seafarer was employed or joined the vessel;
(46) “property”, in relation to a seafarer, includes personal effects;
(47) “reception facilities”, in relation to a port, terminal, shipyard,
ship repair facility or ship recycling facility, means facilities for enabling
vessels using the port terminal, shipyard, ship repair facility or ship
recycling facility to discharge or deposit any substance;
(48) “Registrar” means the Registrar of Indian vessel referred to in
section 18;
(49) “registered owner” means the person or persons registered as the
owner of the vessel;
(50) “Safety Convention” means the international convention for the
Safety of Life at Sea, signed in London on the 1st day of November, 1974
and shall include its protocols;
(51) “sailing vessel” means any primitive or traditionally built
wooden vessel not primarily propelled, provided with sufficient sail area for
navigation under sails alone, whether or not fitted with mechanical means
of propulsion, but does not include a pleasure craft;
(52) “salvage” means any act or activity undertaken to assist a vessel
or any other property in danger in navigable waters or in any other waters
whatsoever;
(53) “Salvage Convention” means the International Convention on
Salvage, 1989, signed in London on the 28th day of April, 1989;
(54)
“salvor” means any person rendering services in direct
connection with salvage operation;
(55) “sea-going”, in relation to a vessel, means a vessel proceeding or
intending to proceed beyond such waters as the Central Government or the
State Government may, by notification, declare to be inland waters;
(56) “seafarer” means any person who is employed or engaged or
works in any capacity onboard a sea-going vessel, but does not include,—
(i) a person who is in the employment or engagement or work
onboard in any capacity in a warship or any Government vessel used
for military or non-commercial purposes; or
(ii) any other person as the Central Government may, by
notification, specify;
() “seafarer’s welfare officer” means the seafarer’s welfare officer
appointed under sub-section (2) of section 12;
() “security”, in relation to maritime security, includes any
measures to protect port facility or vessels or any person or thing relating
directly or indirectly to maritime navigation,—
(i) against terrorism, sabotage, stowaways, illegal migrants,
asylum seekers, piracy, armed robbery, seizure or pilferage; and
(ii) against any other hostile act or influence which threatens the
security in the maritime transport sector,
employed by the owners or operators or persons in charge of the vessels or
management of port facilities, offshore installations and other marine
organisations or establishments, or undertaken by the Central Government;
6 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(59) “ship” means any watercraft, used or capable of being used in
navigation in, above, or under the water; but does not include fishing vessel
or sailing vessels;
(60) “ship owner” means the owner, including the registered owner
and bareboat charterer, of the vessel;
(61) “shipping master” means the shipping master appointed under
section 12;
(62) “shipping office” means the shipping office established under
section 12;
(63) “special trade passenger” means a passenger carried in special
trade passenger vessel in spaces on the weather deck or upper deck or
between decks which accommodate more than eight passengers;
(64) “State” means any country including India;
(65) “Standards of Training, Certification and Watchkeeping for
Seafarers Convention” means International Convention on Standards of
Training, Certification and Watchkeeping for Seafarers, 1978, signed in
London on the 7th day of July, 1978;
(66) “surveyor” means a person appointed under clause (d) of
sub-section (1) of section 8, or section 9;
(67) “tindal” means the person in command or charge of a sailing vessel;
(68) “Tribunal” means the Tribunal constituted under sub-section (1)
of section 89;
(69) “unseaworthy vessel” means vessel, the materials of which she is
made, her construction and design, the number, description and
qualification of the seafarers including officers, the weight, description and
stowage of the cargo and ballast, the condition of her hull and equipment,
boilers and machinery are not such as to render her in every respect fit for
the proposed voyage or service;
(70) “vessel” includes every description of water craft used or capable
of being used in the marine environment, such as ship, boat, sailing vessel,
fishing vessel, submersible, semi-submersible, hydrofoils, non-displacement
crafts, amphibious crafts, wing-in-ground crafts, pleasure crafts, barges,
lighters, Mobile Offshore Drilling Units, Mobile Offshore Units, or of any
other description, whether fitted with mechanical means of propulsion or not;
(71) “voyage” means the passage between the vessel’s port or place of
departure and her final port or place of arrival, including the activities
within the port;
(72) “wages” include emoluments;
(73) “wreck” includes the following, upon a maritime casualty, namely:—
(a) a sunken or stranded vessel; or
(b) any part of a sunken or stranded vessel, including any object
or goods or cargo that is or has been onboard such a vessel;
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 7
Establishment
of National
Shipping
Board.
(c) any object or goods or cargo that is lost at sea from a vessel
stranded, sunken or adrift at sea; or
(d) a vessel that is in distress or is about, or may reasonably be
expected, to sink or to strand, where effective measures to assist the
vessel or any property in danger are not already being taken to the
satisfaction of the Director-General.
PART II
ESTABLISHMENT OF BOARDS AND GENERAL ADMINISTRATION
CHAPTER I
ESTABLISHMENT OF NATIONAL SHIPPING BOARD AND SEAFARER’S WELFARE BOARD
4. (1) With effect from such date as the Central Government may, by
notification, specify in this behalf, there shall be established a Board to be called
the National Shipping Board (hereinafter referred to as the Shipping Board) for
the purposes of this Act.
(2) The Shipping Board shall consist of the following members, namely:—
(a) six members of Parliament of whom four shall be elected from
amongst themselves by members of the House of the People and two from
amongst themselves by the members of the Council of States;
(b) such number of other members, not exceeding sixteen, out of
which at least four shall be women, as the Central Government may think
fit to appoint to the Shipping Board, to represent—
(i) the Central Government;
(ii) ship owners;
(iii) seafarers; and
(iv) such other interests as in the opinion of the Central
Government, ought to be represented on the Shipping Board:
Provided that the Shipping Board shall include an equal number of persons
representing the ship owners and seafarers.
(3) The term of a member elected under clause (a) of sub-section (2) shall
come to an end as soon as he ceases to be a member of the House from which he
was elected.
(4) The Central Government shall nominate one of the members of the
Shipping Board to be its Chairperson.
(5) Notwithstanding anything contained in this section, the Member of
Parliament referred to in clause (a) of sub-section (2) or nominated as
Chairperson under sub-section (4), shall not be deemed to be holding the office of
profit for the purposes of sub-clause (a) of clause (1) of article 102 of the
Constitution.
(6) The Shipping Board shall advise the Central Government,—
(a) on matters relating to Indian shipping including the development
thereof; and
(b) on such other matters arising out of this Act as the Central
Government may refer to it for advice.
(7) The Shipping Board shall have power to regulate its own procedure for
the conduct of its business.
8 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(8) The term of office, manner of filling casual vacancies and travelling and
other allowances payable to, members of the Shipping Board and the service
conditions of the Chairperson, shall be such as may be prescribed.
(9) The Shipping Board shall be assisted by such officers and other
employees and the manner of their appointment and the terms and conditions of
their service shall be such as may be prescribed.
5. (1) With effect from such date as the Central Government may, by
notification specify in this behalf, there shall be constituted an advisory board to
be called as Seafarer’s Welfare Board (hereinafter referred to as the Welfare
Board) for the purposes of advising the Central Government on the measures to
be taken for promoting the welfare of seafarers under this Act, generally and in
particular on the following matters, namely:—
(a) the establishment of hostels or boarding and lodging houses for
seafarers;
(b) the establishment of clubs, canteens, libraries and other like
amenities for the benefit of seafarers;
(c) the establishment of hospital and provision of medical treatment
for seafarers;
(d) the provision of educational and other facilities for seafarers;
(e) the measures to be taken for welfare of distressed or abandoned seafarers;
(f) the measures to be taken in the case of seafarer who is a foreigner
but abandoned in the waters within the jurisdiction of India.
(2) The composition of the Welfare Board, the term of office of members
thereof, the procedure to be followed in the conduct of its business, the travelling
and other allowances payable to, members of the Welfare Board, shall be such as
may be prescribed.
(3) The fee payable by the owners of vessels for the purposes of providing
amenities to seafarers, the procedure by which any such fee may be collected or
recovered and the manner in which the proceeds of such fees, after deduction of
the cost of collection, shall be utilised, shall be such as may be prescribed.
(4) The port based welfare facility and any other measures to be taken for
promoting the welfare of seafarers shall be such as may be prescribed.
6. (1) The Central Government may make rules to carry out the provisions
of this Chapter.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the term of office, manner of filling vacancies and the travelling
and other allowances payable to the members of the Shipping Board and the
service conditions of the Chairperson under sub-section (8) of section 4;
(b) the manner of appointment of officers and other employees of the
Shipping Board and the terms and conditions of their service under
sub-section (9) of section 4;
(c) the composition of the Welfare Board, term of office of its
members, procedure for conduct of business and the travelling and other
allowances payable to such members under sub-section (2) of section 5;
(d) the fee payable by owners of vessels, procedure for collection of
fees and the manner in which the proceeds of such fees shall be utilised
under sub-section (3) of section 5; and
Constitution of
Seafarer’s
Welfare Board.
Power to make
rules.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 9
Director-
General of
Maritime
Administration.
Officers.
(e) the port based welfare facility and other measures to be taken for
promoting the welfare of seafarers under sub-section (4) of section 5.
CHAPTER II
MARITIME ADMINISTRATION
7. (1) The Central Government may, by notification, appoint a person to be
the Director-General of Maritime Administration for the purposes of exercising
or discharging the powers, authority or duties conferred or imposed upon him by
or under this Act.
(2) The Central Government may, by general or special order, direct that
any power, authority or jurisdiction exercisable by it under or in relation to any
such provisions of this Act as may be specified in the order shall, subject to such
conditions and restrictions as may be so specified, be exercisable also by the
Director-General or such other officer as may be specified in the order.
(3) The Director-General may, with the previous approval of the Central
Government, by general or special order, direct that any power or authority
conferred upon or delegated to, and any duty imposed upon him by or under this
Act may, subject to such conditions and restrictions as he may think fit to impose,
be exercised or discharged also by such officer or other authority as he may
specify in this behalf.
(4) Every officer specified in section 8 shall discharge their functions under
the general superintendence and control of the Director-General.
8. (1) There shall be the following officers to be appointed by the Central
Government who shall discharge the duties and functions under this Act,
namely:—
(a) Additional Director-General;
(b) Deputy Director-General;
(c) Assistant Director-General;
(d) Surveyors, which shall include the following, namely:―
(i) nautical advisor;
(ii) chief surveyor;
(iii) chief ship surveyor;
(iv) principal officer;
(v) deputy nautical advisor;
(vi) deputy chief surveyor;
(vii) deputy chief ship surveyor;
(viii) nautical surveyor;
(ix) engineer and ship surveyor;
(x) ship surveyor;
(xi) junior ship surveyor;
(e) shipping master which shall include deputy or assistant shipping
master;
(f) director which shall include deputy director or assistant director;
(g) senior radio surveyor;
(h) radio inspector;
10 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(i) seafarer’s welfare officer;
(j) any other officer as may be notified by the Central Government.
(2) The salary, allowances and other terms and conditions of service of the
officers specified in sub-section (1) shall be such as may be prescribed.
9. The Central Government may, by notification, appoint, as many persons
as it may think fit to be surveyors for the purposes of this Act:
Provided that the Central Government may, by notification, authorise any
person or body of persons, on such terms and conditions as may be specified
therein, to be surveyor for the purposes of this Act.
10. (1) The Central Government may, by notification, appoint, as many
senior radio surveyors and radio inspectors as it may consider necessary for the
purpose of securing compliance with the requirements of this Act and the rules
made thereunder relating to radio communication.
(2) The powers and functions of the senior radio surveyors and radio
inspectors shall be such as may be prescribed.
11. (1) The Central Government may establish and maintain at each of the
ports of Mumbai, Kolkata, Chennai, Kochi, Kandla and such other ports or places
in India, as it may consider necessary, an office of the Mercantile Marine
Department for the administration of this Act and the rules made thereunder.
(2) The Central Government may, by notification, appoint a person to be
the principal officer who shall be incharge of the office of the Mercantile Marine
Departments at the ports of Mumbai, Kolkata, Chennai, Kochi, Kandla and any
other port or places notified by the Central Government.
(3) The Central Government may, by notification, specify the office of the
Mercantile Marine Department at any other port or place which shall be in the
charge of such officer as the Central Government may appoint in this behalf.
12. (1) The Central Government may, by notification, establish a shipping
office at every port in India in which it thinks it necessary so to do, and shall as it
may consider necessary, appoint thereto—
(a) a shipping master and as many deputy shipping masters and
assistant shipping masters as may be required;
(b) a director and as many deputy directors and assistant directors as
may be required; and
(c) seafarer’s welfare officers.
(2) The Central Government may appoint seafarer’s welfare officers at such
ports in or outside India as it may consider necessary.
(3) The Central Government may direct that at any port at which no
separate shipping office is established, the whole or any part of the business of
the shipping office shall be conducted at such office as the Central Government
may specify, and thereupon the same shall be conducted accordingly.
13. (1) The Central Government may, by notification, constitute a body for
the security of vessels and port facilities, with such name and to be headed by an
officer with such designation, as may be specified therein.
(2) The administration of the body shall vest in the officer who shall head
the body constituted under sub-section (1).
(3) The body constituted under sub-section (1) shall be responsible for
carrying out the regulatory and oversight function in respect of such matters
relating to security of vessels and port facilities as may be prescribed:
Surveyors.
Senior radio
surveyors and
radio inspectors.
Mercantile
Marine
Department.
Shipping office.
Body for
security of
vessels and port
facilities.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 11
Application of
this Part.
Indian vessel
and its
registration.
Provided that while framing rules under this sub-section, the Central
Government shall take into consideration the provisions of the International Ship
and Port Facility Security Code under the Safety Convention.
(4) Without prejudice to the provisions of sub-section (3), the body
constituted under sub-section (1) shall perform the following functions, namely:—
(a) provide regulatory framework for security of vessels and port
facilities;
(b) ensure timely collection and exchange of security related
information with regard to vessels and port facilities;
(c) coordinate with other agencies;
(d) any other functions as may be prescribed.
PART III
REGISTRATION OF VESSELS
14. This Part shall apply to sea-going vessels.
15. (1) No vessel shall be an Indian vessel unless such vessel is owned by
any of the following persons and in such proportion of ownership as may be
notified by the Central Government, namely:—
(a) a citizen of India including a Non-Resident Indian or an Overseas
Citizen of India; or
(b) a company or a body established by or under any Central Act or State
Act having its registered office or principal place of business in India; or
(c) such other person or body as the Central Government may, by
notification, specify in this behalf.
(2) No vessel which is wholly owned by an Overseas Citizen of India shall
be required to be registered as an Indian vessel.
(3) The Central Government may, by notification, declare any port or place
as a port of registry under this Act and every Indian vessel shall be registered
under this Part.
(4) Any vessel registered at a port in India under any enactment repealed by
this Act shall, at the commencement of this Act, be deemed to have been
registered under this Act and recognised as an Indian vessel.
(5) Subject to any exemptions or modifications made by the Central
Government, all vessels belonging to the Government, other than vessels of the
Indian Navy, Indian Coast Guard, customs authorities, Central Armed Police
Forces and police, shall be registered under this Act.
(6) Notwithstanding anything contained in this section, an Indian vessel
may be registered in a State other than India subject to such conditions as
may be prescribed.
(7) Any Indian vessel proceeding to sea without a valid certificate of
registration under this Act shall be detained until a valid certificate of registration
is produced to the proper officer.
(8) A vessel other than an Indian vessel abandoned in Indian waters
which is subsequently acquired by an entity eligible to register a vessel under
12 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
49 of 2019
this Act may be registered under this Act in accordance with such procedure
as may be prescribed.
16. Any foreign vessel chartered on a bareboat charter-cum-demise contract
by an Indian charterer may be registered under this Part in such manner and
subject to such conditions as may be prescribed.
Explanation.—For the purposes of this section, “bareboat charter-cum-demise”
means a bareboat charter where the ownership of the vessel is intended to be
transferred after a specified period to the charterer to whom it has been chartered.
17. Any vessel not registered under this Act which is sought to be recycled in
India in accordance with the provisions of the Recycling of Ships Act, 2019 and the
rules made thereunder, may be registered temporarily under this Part in such
manner, for such duration and subject to such conditions as may be prescribed.
18. The principal officer of the Mercantile Marine Department or such person
as the Central Government may, by notification authorise, shall be the Registrar of
Indian vessels at such port of registry as may be specified in the notification.
19. (1) If, at any port or place a vessel becomes entitled to be registered as
an Indian vessel, the Registrar may grant a provisional certificate of registration
in accordance with such procedure as may be prescribed and such provisional
certificate shall have the effect of a certificate of registration.
(2) The procedure for validity and extension or cancellation of such
registration shall be such as may be prescribed.
(3) The unsatisfied mortgage shall continue to be reflected in the register
book in case of deemed closure of the provisional registration.
20. (1) An Indian vessel shall be registered in accordance with such
procedure, for such period and on payment of such fee as may be prescribed.
(2) On the expiry of the period specified in sub-section (1), the registration
of the vessel shall be renewed in accordance with such procedure and on payment
of such fee as may be prescribed.
(3) The Director-General shall, by way of an order, specify certain
conditions for an Indian vessel and for different classes of vessels sought to be
registered under this Act.
(4) Where it appears to the Registrar that there is any doubt as to the title of
any Indian vessel, he may require evidence to be given to his satisfaction that the
vessel is entitled to be registered as an Indian vessel in such manner and in
accordance with such procedure as may be prescribed.
(5) The Registrar shall, on being satisfied with the requirements of this
section, grant—
(a) a certificate of registration containing the particulars of the vessel
as entered in the register book in such form and manner as may be
prescribed;
(b) a tonnage certificate containing the gross and net tonnage as
determined in such manner as may be prescribed.
(6) In the event of the certificate of registration being defaced or mutilated,
a new certificate shall be granted in lieu of the original certificate in such manner
as may be prescribed.
Registration of
Indian chartered
foreign vessels.
Temporary
registration of
vessels sought to
be recycled.
Registrar of
Indian vessels.
Provisional
registration of
Indian vessel.
Procedure for
registration of
Indian vessels.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 13
Temporary
pass in lieu of
certificate of
registration.
Custody and
use of
certificate.
Transfer of
Indian vessel
or shares.
(7) In the event of a registered vessel being,—
(a) actually, or constructively lost;
(b) taken by the enemy;
(c) burnt or broken up;
(d) for any reason, ceasing to be an Indian vessel; or
(e) registered under any other law for the time being in force at the
relevant time,
every owner of such vessel shall immediately on obtaining knowledge of the
event, comply with such procedure as may be prescribed.
(8) Every Indian vessel shall be described by such name, call sign and
official number in such manner as may be prescribed.
(9) Every Registrar shall keep a register book, make entries in that book
and maintain the records of vessels registered under the provisions of this Act, in
such manner as may be prescribed.
(10) Where there is a change in ownership of a registered Indian vessel, the
Registrar of the port of registry shall register the name of new owner and grant a fresh
certificate of registration, in accordance with such procedure as may be prescribed.
21. Where, pursuant to an application for registration made before the
Registrar, a certificate of registration has not been granted to a vessel within the
specified period, but it appears to the Central Government that by reason of such
special circumstances as may be prescribed, it is desirable that permission should
be granted to any Indian vessel to proceed on a voyage, the Central Government
may authorise the Registrar to grant a pass in such form as may be prescribed,
and that pass shall for the period and within the limits mentioned therein have the
same effect as a certificate of registration.
22. (1) The certificate of registration shall be used only for the lawful
navigation of the vessel and shall at all times remain in the custody of the person
in charge of the vessel and shall not be subject to detention by reason of any title,
lien, charge or interest whatever, had or claimed by any owner, mortgagee or
other person to, on or in the vessel.
(2) No person, whether interested in a vessel or not who has in his
possession or under his control the certificate of registration of a vessel shall
refuse or omit without reasonable cause, to deliver such certificate on demand, to
the person entitled to the custody thereof for the purposes of the lawful
navigation of the vessel or, to any Registrar or other person entitled by law to
require such delivery.
(3) If the master or owner of an Indian vessel uses or attempts to use for her
navigation a certificate of registration not legally granted in respect of the vessel,
he shall be guilty of an offence under this sub-section and the vessel shall be
liable to forfeiture.
23. (1) No person shall transfer or acquire any Indian vessel or any share or
interest therein at any time during which the security of India or any part of the
territory thereof is threatened by sanction, war or external aggression and a
proclamation of emergency issued under clause (1) of article 352 of the
Constitution is in operation, without the previous approval of the Central
Government and any transaction effected in contravention of this provision shall
be void and unenforceable.
(2) The Central Government may, if it considers necessary or expedient so
to do for the purpose of conserving the tonnage of Indian shipping, by order,
refuse to give its approval to any such transfer or acquisition in the circumstances
referred under sub-section (1).
14 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(3) No transfer or acquisition of any Indian vessel shall be valid unless,—
(a) all mortgages entered in its register are satisfied or the mortgagee
has given his consent in writing for the transfer of the vessel;
(b) all wages and other amounts due to seafarers in connection with
their employment on that vessel have been paid in accordance with the
provisions of this Act;
(c) any subsisting entry has been made of any court order prohibiting
transfer or any dealing with that vessel;
(d) any unpaid statutory fees that may be levied on the vessel has been
paid and informed in writing to the Registrar.
(4) Subject to the provisions contained in this section, an Indian vessel or a
share therein shall be transferred, only by an instrument, in such form and manner
as may be prescribed.
(5) The instrument for the transfer of an Indian vessel or of a share therein
shall be registered by the Registrar in accordance with such procedure as may be
prescribed.
24. The property in an Indian vessel or share therein may be transmitted to a
person on the death or insolvency of any registered owner or by any lawful means
other than by a transfer under this Act subject to such conditions as may be
prescribed.
25. Where, by reason of the transmission of any property in a vessel or a
share therein on death, insolvency or otherwise, a vessel ceases to be an Indian
vessel, it may be ordered to be sold in such manner as may be prescribed.
26. (1) The mortgage of an Indian vessel shall be in the prescribed form and
on the production of such instrument, the Registrar of Indian vessel’s port of
registry shall record it in the register book in such manner as may be prescribed.
(2) Mortgages shall be recorded by the Registrar in the order of time in
which they are produced to him for that purpose, and the Registrar shall, by
memorandum under his hand, notify on each mortgage that it has been recorded
by him stating the day and hour of that record.
(3) Except in so far as may be necessary for making a mortgaged vessel or
share available as a security for the mortgage debt, the mortgagee shall not, by
reason of his mortgage, be deemed to be the owner of the vessel or share, nor
shall the mortgagor be deemed to have ceased to be owner thereof.
(4) Where a registered mortgage is discharged, the Registrar shall, on the
production of such documents as may be prescribed, make an entry in the register
book to the effect that the mortgage has been discharged, and on that entry being
made, the estate, if any, which passed to the mortgagee shall vest in the person in
whom (having regard to intervening acts and circumstances, if any) it would have
vested, if the mortgage had not been made.
(5) If there are more than one recorded mortgage in respect of the same
vessel or share, the mortgagees shall, notwithstanding any express, implied or
constructive notice, have priority according to the date and time on which each
mortgage is recorded in the register book and not according to the date of each
mortgage itself.
27. (1) Where there is only one registered mortgagee of a vessel or share, he
shall be entitled to recover the amount due under the mortgage by selling the
mortgaged vessel or share without approaching the High Court:
Transmission of
property in Indian
vessel on death,
insolvency, etc.
Order for sale
where vessel has
ceased to be an
Indian vessel.
Mortgage of
vessel or share.
Rights of
mortgagee.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 15
Liability of
mortgagee.
Mortgage not
ffected by
nsolvency.
Transfer of
mortgages.
Transmission
f interest in
mortgage in
ertain
ircumstances.
Rules as to
name of
vessel.
Provided that nothing contained in this sub-section shall prevent the mortgagee
from recovering the amount so due in the High Court as provided in sub-section (2).
(2) Where there are two or more registered mortgagees of a vessel or share,
they shall be entitled to recover the amount due under the mortgage in the High
Court, and when passing a decree or thereafter the High Court may direct that the
mortgaged vessel or share be sold in execution of the decree.
(3) Every registered mortgagee of a vessel or share who intends to recover
the amount due under the mortgage by selling the mortgaged vessel or share
under sub-section (1) shall give a notice relating to such sale to the Registrar of
Indian vessel’s port of registry in such form as may be prescribed.
(4) The notice under sub-section (3) shall be accompanied with the proof of
payment of the wages due to the seafarers in connection with their employment
on that vessel.
28. When, during the continuance of the mortgage, the mortgagee takes
possession of the mortgaged vessel or is asserting a claim before the court for
possession of the vessel, he shall be responsible for—
(a) managing the vessel as if it were his own vessel;
(b) making such necessary repairs to the mortgaged vessel as may be
required for the smooth operation and normal functioning of the vessel;
(c) ensuring that no act is committed which is destructive or permanently
injurious to the vessel; and
(d) such other liability as may be prescribed.
29. A registered mortgage of a vessel or share shall not be affected by any act of
insolvency committed by the mortgagor after the date of the record of such mortgage,
notwithstanding that the mortgagor, at the commencement of his insolvency, had the
vessel or share in his possession, order or disposition, or was the reputed owner thereof,
and the mortgage shall be preferred to any right, claim or interest therein of the other
creditors of the insolvent or any trustee or assignee on their behalf.
30. (1) A registered mortgage of a vessel or share may be transferred to any
person in such manner and the instrument effecting the transfer shall be in such
form as may be prescribed.
(2) The person to whom any such mortgage has been transferred shall enjoy
the same right of preference as was enjoyed by the transferor.
31. The transmission of the interest of a mortgagee in a vessel or share on death,
or insolvency, or by any lawful means other than by a transfer under this Act shall be in
accordance with such procedure and subject to such conditions as may be prescribed.
32. (1) An Indian vessel shall not be described by any name other than that
by which she is for the time being registered.
(2) The Registrar may refuse the registration of any Indian vessel by the
name by which it is proposed if that name is already borne by another vessel or if
the name be so similar as is calculated or likely to deceive.
(3) A change shall not be made in the name of an Indian vessel except in
such manner as may be prescribed.
(4) If any person acts or suffers any person under his control to act in
contravention of this section or omits to do or suffers any person under his
control to omit to do anything required under this section, the vessel may be
detained until the provisions of this section are complied with:
16 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
Provided that nothing in this sub-section shall apply to a foreign vessel
which has become, and is sought to be registered as, an Indian vessel.
33. When a registered vessel is so altered as not to correspond with the
particulars relating to her tonnage or description contained in the register
book, then, if the alteration is made at any port having a Registrar, that
Registrar, or if it is made elsewhere, the Registrar of the first port at which
the vessel arrives after the alteration, shall, on an application being made to
him by the owner stating the particulars of the alteration, either cause the
alteration to be registered or direct that the vessel be re-registered:
Provided that in case the vessel so altered is outside Indian port, the
Registrar may on report of inspection of such vessel by a surveyor or the
person authorised under sub-section (1) of section 9, re-register the vessel
without any requirement of the vessel to visit Indian port.
34. Where any Registrar, not being the Registrar of the vessel’s port of
registry, on an application as to an alteration in a vessel directs the vessel to
be re-registered, he shall either grant a provisional certificate describing the
vessel as altered, or provisionally endorse the particulars of the alteration on
the existing certificate.
35. The registration of any vessel may be transferred from one port or
place of registry to another on an application to the Registrar of the existing
port or place of registry of the vessel made by declaration in writing of all
persons appearing in the register to be interested therein as owners or
mortgagees, but that transfer shall not in any way affect the rights of those
persons or any of them and those rights shall in all respects continue in the
same manner as if no such transfer had been effected.
36. Where a vessel has ceased to be registered as an Indian vessel by
reason of having been wrecked or abandoned, or for any reason other than
capture by the enemy, the vessel shall not be re-registered until she has, at the
expense of the applicant, been surveyed by a surveyor and certified by him to
be seaworthy.
37. (1) The Central Government may, by notification, declare the proper
national colours for all Indian vessels and for all vessels owned by the
Government and different colours may be declared for different classes of
vessels.
(2) Vessels registered under this Part shall hoist the proper national
colours,—
(a) on a signal being made to her by any vessel of the Indian Navy
or Indian Coast Guard;
(b) on entering or leaving any port.
(3) Any commissioned officer of the Indian Navy or an officer of the
Indian Coast Guard or a surveyor or an Indian ambassador may board any
vessel on which any colours are hoisted contrary to this Act and seize and
take away the colours which shall be forfeited to the Government.
(4) No person onboard a vessel which is not an Indian vessel shall, for
the purpose of making it appear to be an Indian vessel, use the Indian national
colours, unless the assumption of Indian character has been made for the
purpose of escaping capture by the enemy or by a foreign vessel of war in the
exercise of some belligerent right.
Registration of
alterations.
Provisional
certificate and
endorsement
where vessel is
to be
re-registered.
Transfer of
registration.
Restrictions on
re-registration of
abandoned
vessel.
National colours
for Indian
vessels.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 17
Concealment
of Indian or
assumption of
foreign
character.
Liabilities of
vessel not
recognised as
Indian vessel.
Proceedings
on forfeiture
of vessel.
Liability of
owners.
Evidence of
register book,
certificate of
registration
and other
documents.
Closure of
registration.
38. No owner or master of an Indian vessel shall knowingly do anything
or permit anything to be done, or carry or permit to be carried any papers or
documents, with intent to conceal the Indian character of the vessel from any
person entitled by any law for the time being in force to inquire into the same,
or with intent to assume a foreign character for the vessel, or with intent to
deceive any person so entitled.
39. Where it is declared by this Act that an Indian vessel shall not be
recognised as such, that vessel shall not be entitled to any privileges, benefits,
advantages or protection usually enjoyed by Indian vessel or to use the Indian
national colours for Indian vessel or to assume the Indian national character
but so far as regards the payment of dues, the liability to fine or penalty and
forfeiture and the punishment of offences committed onboard such vessel or
by any person belonging to her, such vessel shall be dealt with in the same
manner in all respects as if she were a recognised Indian vessel.
40. Where any vessel has either wholly or as to any share therein
become subject to forfeiture under this Part, any commissioned officer of the
Indian Navy or Indian Coast Guard or an Indian ambassador or any other
officer authorised by the Central Government, may seize and detain the
vessel, under the directions of the proper officer and bring her for
adjudication before the High Court and the High Court may thereupon
adjudge the vessel with her equipment to be forfeited to the Government and
make such order in the case as the High Court seems just and may award to
the officer bringing in the vessel for adjudication such portion of the proceeds
of the sale of the vessel or any share therein as the High Court thinks fit.
41. Where any person is beneficially interested otherwise than by way of
mortgage, in any vessel or share in a vessel registered in the name of some
other person as owner, the person so interested as well as the registered owner
shall be subject to all the pecuniary penalties or fine imposed by this Act or
any other law for the time being in force on the owners of vessel or shares
therein, and proceedings for the enforcement of any such penalties or fine
may be taken against both or either of the said parties jointly or severally.
42. (1) A person may on application to the Registrar and on payment of
such fees as may be prescribed, inspect any register book, and may obtain a
certified copy of any entry in the register book.
(2) A certified copy of an entry in a register book shall be admissible in
evidence in any court and have the same effect to all intents as the original entry
in the register book of which it is a copy.
43. (1) The owner of an Indian vessel may make an application to the
Registrar in such form and manner as may be prescribed, to close its registration
if there is no—
(a) unsatisfied mortgage entered in its register; or
(b) outstanding claims of the master or seafarer of the vessel in
respect of wages which have been intimated.
(2) On receipt of the application under sub-section (1), the Registrar shall, if he
is satisfied, by an order, close the registration of the vessel and make an entry thereof
in the register and forward the copy of closure report to the Director-General.
Explanation.—For the purposes of this section, “owner” includes any
transferee of, or any person entitled under a transmission to the property in, an
Indian vessel.
18 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
44. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the conditions for registration of an Indian vessel under sub-section (6)
of section 15;
(b) the procedure for registration of an abandoned vessel under
sub-section (8) of section 15;
(c) the manner and conditions for registration of a foreign vessel
chartered on a bareboat charter-cum-demise contract by an Indian charterer
under section 16;
(d) the manner, duration and conditions for temporary registration of a
vessel sought to be recycled under section 17;
(e) the procedure for issuance of provisional certificate of registration
under sub-section (1) and the procedure, validity, and extension of such
registration or cancellation under sub-section (2), of section 19;
(f) the procedure, period and fees for registration and renewal thereof,
of an Indian vessel under sub-section (1) and sub-section (2) of section 20;
(g) the manner and procedure in accordance with which the Registrar
may require evidence to be given for the purposes of inquiring into the title
of an Indian vessel under sub-section (4) of section 20;
(h) the form and manner of grant of certificate of registration and manner
of determination of gross and net tonnage under sub-section (5) of section 20;
(i) the manner of granting new certificate in lieu of original certificate of
registration being defaced or mutilated under sub-section (6) of section 20;
(j) the compliance of procedure by the owner of registered vessel
under sub-section (7) of section 20;
(k) the manner of description of the name, call sign and official
number of Indian vessels under sub-section (8) of section 20;
(l) the manner of keeping the register book and making entries therein
and maintenance of the records of vessels registered under this Act under
sub-section (9) of section 20;
(m) the procedure for registration and issuance of a fresh certificate
under sub-section (10) of section 20;
(n) the special circumstances for grant of temporary pass and the form
in which such pass shall be granted under section 21;
(o) the form and manner of instrument by which an Indian vessel or
share therein shall be transferred under sub-section (4) of section 23;
(p) the procedure for registration of the instrument by which an Indian
vessel or a share therein shall be transferred under sub-section (5) of section 23;
(q) the procedure for transmission of property in Indian vessel on
death, insolvency, etc., under section 24;
(r) the manner in which a vessel ceasing to be an Indian vessel is
ordered for sale under section 25;
(s) the form of mortgage and the procedure and manner in which the
Registrar shall record the mortgage in the register book, under sub-section (1) of
section 26;
Power to make
rules.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 19
Certificates to
be held by
seafarers.
Certificate of
competency
and certificate
of proficiency.
(t) the documents required to be produced for the discharge of a
registered mortgage of a vessel under sub-section (4) of section 26;
(u) the form of notice under sub-section (3) of section 27;
(v) the other liabilities of mortgagee under clause (d) of section 28;
(w) the manner for transfer of mortgage and the form of instrument
effecting the transfer of mortgage, under sub-section (1) of section 30;
(x) the procedure and conditions for transmission of interest in
mortgage under section 31;
(y) the manner in which the name of an Indian vessel may be
changed under sub-section (3) of section 32;
(z) the fee for inspection of register book and a certified copy of
any entry of the register book under sub-section (1) of section 42;
(za) the form and manner of application for closure of registration
under sub-section (1) of section 43;
(zb) any other matter which is required to be or may be prescribed.
PART IV
MARITIME EDUCATION AND TRAINING
45. (1) Every Indian vessel shall have seafarers with manning scales,
based on categories of vessel, areas and types of operations, as may be
prescribed.
(2) The seafarer shall hold certificate of competency or certificate of
proficiency granted under section 46 appropriate to his rank in the vessel, or
of such higher grade, as may be prescribed:
Provided that an Indian national, including Overseas Citizen of India
with such certificate or foreign certificate of competency recognised by the
Director-General, may serve on Indian vessels subject to such conditions and
restrictions as may be prescribed.
46. (1) An officer notified by the Central Government as the issuing
authority shall, subject to the provisions of the Standards of Training,
Certification and Watchkeeping for Seafarers Convention, grant a certificate
of competency or certificate of proficiency for different grades of seafarers
with such requirements and procedures as may be prescribed.
(2) No certificate of competency or certificate of proficiency shall be
granted under sub-section (1), unless the seafarer fulfils the requirements in
respect of service, age limit, medical fitness, approved training courses
including onboard training, qualifications and examination in accordance with
the Standards of Training, Certification and Watchkeeping for Seafarers
Convention.
(3) Notwithstanding anything contained in sub-sections (1) and (2), the
issuing authority notified under sub-section (1) may grant such other
certificate of competency or certificate of proficiency with such requirements
and procedures as may be prescribed.
(4) The form, fee, period of validity and the manner of keeping record of
a certificate of competency or certificate of proficiency shall be such as may
be prescribed.
20 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
47. (1) The Director-General shall administer, supervise and monitor all
activities relating to maritime education, training and assessment and approve the
training institutes, training courses including onboard training, as applicable and
method of conduct of such training course for the grant of certificate of
competency or certificate of proficiency under this Part.
(2) No certificate of competency or certificate of proficiency referred to in
sub-section (1) shall be granted unless the training required for certification under
the Standards of Training, Certification and Watchkeeping for Seafarers
Convention is imparted in accordance with the provisions of this section.
(3) The Director-General may, for the purposes of this Part, authorise a
surveyor or any person or body of persons to inspect any maritime training
institute and the person so authorised in this behalf shall submit the report to the
Director-General.
(4) The Director-General may, after receipt of the inspection report under
sub-section (3), if he is satisfied that the maritime training institute has
contravened any provisions of this Part, suspend or withdraw the approval
granted to such maritime training institute after giving the institute an
opportunity of being heard.
(5) The Central Government, on receipt of any information pertaining to any
training institute operating without obtaining approval of the Director-General under
sub-section (1), may undertake action against such institute in accordance with such
procedure as may be prescribed.
(6) Every pilot or person performing the duties of a pilot at any port shall,
from time to time, undergo such training and possess such certificates as the
Director-General may by order, specify.
48. (1) The Central Government shall appoint such persons having the
qualifications in accordance with the Standards of Training, Certification and
Watchkeeping for Seafarers Convention as examiners for the purposes of
assessing and examining the competence of persons desirous of obtaining
certificates of competency or proficiency under this Part.
(2) The nautical advisor shall be the Chief Examiner for the master and
deck department personnel and the chief surveyor shall be the Chief examiner for
engine department personnel:
Provided that in the absence of the nautical advisor and the chief surveyor,
the Central Government may authorise any surveyor to act as the chief examiner.
(3) The manner of conducting examination for certificate of competency or
certificate of proficiency, the fees to be charged and the payment to be made to
the examiners appointed under sub-section (1), shall be such as may be
prescribed.
(4) The issuing authority referred to in sub-section (1) of section 46 shall
grant the certificate of competency or certificate of proficiency to every applicant
duly reported by the examiners to have passed the examination and achieved the
desired level of competence for that grade of certificate with satisfactory
evidence of his sobriety, experience, ability and general good conduct onboard
vessel.
(5) If the issuing authority is not satisfied with the report of the examiner,
he may require re-examination of the applicant including inquiry into the
applicant’s testimonials and character.
Training for
grant of
certificate of
competency and
certificate of
proficiency.
Examination for
grant of
certificates.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 21
Production of
ertificate of
ompetency.
Recognition of
ertificates of
ompetency
ranted in
ther States.
Foreign vessel
not to sail
without
eafarers
having
ertificate.
(6) If it appears to the issuing authority that a person holding a certificate
of competency or certificate of proficiency has obtained it based on false or
erroneous information, or is guilty of indiscipline or misconduct, incompetency,
or any act of omission or commission or compromise to safety, security or
prevention of pollution which may pose a threat to life or property or
environment, he may, after due investigation, by order, withdraw, suspend or
cancel such certificate:
Provided that no order shall be passed under this sub-section without
giving the person holding the certificate a reasonable opportunity of being
heard.
(7) The person whose certificate is withdrawn, suspended or cancelled by
the issuing authority under sub-section (6) may appeal against such order, in
accordance with such procedure as may be prescribed, before such officer as
the Central Government may, by notification specify, as the appellate authority.
(8) Whenever a person holding a certificate granted under this Part proves
to the satisfaction of the issuing authority that he has lost or is deprived of such
certificate, the issuing authority shall, on payment of such fee as may be
prescribed, grant a copy of the certificate and such copy shall have all the
effects of the original certificate.
49. (1) The master of every vessel shall on demand, produce to the proper
officer the certificates of competency of the seafarers of the vessel along with a
list containing the particulars of grades of certificates of the seafarers including
the master.
(2) A surveyor may at any reasonable time, go onboard a vessel to which
any of the provisions of this Part applies, for the purpose of ensuring that the
seafarers holding certificates granted in accordance with the Standards of
Training, Certification and Watchkeeping for Seafarers Convention are actually
appointed and are present, and satisfy himself about the adequacy of such
seafarers for the watchkeeping duties in ports and at sea.
50. (1) Where in a State other than India, certificate of competency is
granted under any law for the time being in force in that State which is
similar to those referred to in this Act, then if the Central Government is
satisfied that,—
(a) the conditions under which any certificate of competency is
granted in that State are not lower than the standards required for the grant
under this Act for corresponding certificates; and
(b) the certificate granted under this Act is accepted in that State in
lieu of the corresponding certificate granted under the laws of that State,
the Central Government may, by notification, declare that any certificate of
competency granted under the law in force in that State shall be recognised as
equivalent to the corresponding certificate of competency granted under this
Act.
(2) The certificate recognised under this section as equivalent may be
issued with a certificate of endorsement as may be prescribed and a person
holding such certificate of endorsement shall be considered as duly certificated
under this Act.
51. (1) Every master of a foreign vessel shall, before proceeding to sea
from any port or place in India, ensure that the vessel has the requisite number
of seafarers of appropriate grades in compliance with the Safety Convention
and Standards of Training, Certification and Watchkeeping for Seafarers
Convention.
22 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(2) A surveyor or any person authorised in this behalf by the Central
Government may, at any reasonable time, go onboard a vessel for the purpose of
ensuring that the seafarers holding certificates granted in accordance with the Safety
Convention and Standards of Training, Certification and Watchkeeping for Seafarers
Convention are actually appointed and are present, and satisfy himself about the
adequacy of such seafarers for the watchkeeping duties in ports and at sea.
(3) If a surveyor or any person authorised under sub-section (2) reports any
deficiency in a foreign vessel in relation to the requirements of the Safety
Convention and Standards of Training, Certification and Watchkeeping for
Seafarers Convention and the Central Government is satisfied that it is unsafe for
such vessel to proceed to sea, that vessel may be detained by the proper officer
till such requirements are fulfilled.
52. Every Indian citizen holding a certificate of competency or certificate of
proficiency or certificate recognised under section 50, shall, at any time during
which the security of India is threatened or during a proclamation of emergency
issued under clause (1) of article 352 of the Constitution, be liable to serve on
Indian vessel for such period and on such terms and conditions as the Central
Government may, by general or special order, specify in this behalf.
53. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the manning scales of the seafarers based on different categories of
vessel, areas and types of operations under sub-section (1) of section 45;
(b) the grade of a certificate and the conditions and restrictions subject
to which seafarers may serve on Indian vessels under sub-section (2) of
section 45;
(c) the requirements and procedure for grant of certificate of
competency or certificate of proficiency to the different grades of seafarer
under sub-section (1) of section 46;
(d) the requirement and procedure for grant of other certificates of
competency or certificates of proficiency under sub-section (3) of section 46;
(e) the form of certificate, fees and the validity of such certificate and
the manner in which the records of certificates are to be kept under
sub-section (4) of section 46;
(f) the procedure in accordance with which the Central Government
may undertake action against training institutes operating without approval
of the Director-General under sub-section (5) of section 47;
(g) the manner of conducting examination for certificate of competency
or certificate of proficiency, fee to be charged and payment to be made to the
examiners under sub-section (3) of section 48;
(h) the procedure in accordance with which a person may appeal
before the appellate authority against the order passed by the issuing
authority under sub-section (7) of section 48;
(i) the fee for grant of certificate if lost or deprived, under sub-section (8) of
section 48;
(j) the certificate of endorsement under sub-section (2) of section 50;
(k) any other matter which is required to be or may be prescribed.
Obligations of
certain
certificate
holders to serve
on Indian
vessels.
Power to make
rules.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 23
Application of
this Part.
Definitions.
Classification
of seafarers.
Application of
maritime
labour
standards to
seafarers and
vessels.
PART V
SEAFARERS
54. Save as otherwise provided, this Part shall apply to,—
(a) every seafarer;
(b) recruitment and placement service; and
(c) ship owners.
55. In this Part, unless the context otherwise requires,—
(a) “Declaration of Maritime Labour Compliance” means a
declaration issued by the Central Government or by any officer,
authority or organisation authorised by the Central Government in this
behalf, in respect of a vessel that it meets with the requirements and
standards set out in the provisions of the Maritime Labour Convention;
(b) “recruitment and placement service” means any person,
company, institution, agency or other organisation, in public or private
sector which is engaged in recruiting seafarers on behalf of employers or
placing seafarers with the employers;
(c) “ship owner” means the owner of the ship or any organisation
or person, such as the manager, agent or bareboat charterer, who has
assumed the responsibility for the operation of the ship from the owner
and who, on assuming such responsibility, has agreed to take over the
duties and responsibilities imposed on ship owners in accordance with
the Maritime Labour Convention, even if any other organisation or
persons fulfil certain of the duties or responsibilities on behalf of the
ship owner.
56. (1) Notwithstanding anything contained in any other law for the time
being in force, the provisions of this Act shall apply to any person employed
or engaged as a seafarer.
(2) The Central Government shall make rules for the classification of
seafarers into different categories, the minimum manning scale of seafarers of
such categories, and the different scales for different classes of vessels.
(3) Seafarers shall be deemed to be key workers, for the purposes of
facilitation of safe and unhindered movement for embarking or disembarking a
vessel, shore leave, and when necessary, for shore-based medical treatment.
57. (1) The provisions relating to maritime labour standards as contained
in the Maritime Labour Convention, shall apply to all seafarers and vessels
registered under this Act, but shall not apply to,—
(a) vessels which navigate exclusively in inland waters or waters
within, or closely adjacent to, sheltered waters or areas where any law
for the time being in force relating to ports apply;
(b) vessels engaged in fishing activities;
(c) traditionally built vessels such as dhows and junks;
(d) vessels of war or naval auxiliaries.
24 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(2) Every vessel registered under this Act and every vessel other than an
Indian vessel while within the jurisdiction of India shall, subject to such
conditions as may be prescribed, be in possession of a certificate granted in
accordance with the provisions of the Maritime Labour Convention.
(3) No vessel shall proceed to sea unless it is in possession of the certificate
referred to in sub-section (2).
(4) The ship owner and the recruitment and placement service provider
shall jointly and severally be liable to discharge the responsibilities of the ship
owner and such service provider shall be deemed to be the ship owner for the
purposes of offences and penalties under sections 281 and 282.
58. (1) It shall be the duty of the shipping master to—
(a) monitor and facilitate the engagement and discharge of seafarers
in the manner provided under this Act;
(b) provide means for securing the presence onboard at the proper
times of seafarers who are so engaged;
(c) grant such continuous discharge certificate and seafarer’s identity
documents in such form and manner as may be prescribed;
(d) hear and decide disputes between a master, ship owner or his agent
and any of the seafarers;
(e) transmit the complaint of any dispute arising in the territorial
waters of India, of a foreign seafarer with the master, ship owner or his
agent in respect of a vessel registered in a State other than India, to the
competent authority of the country of registration and a copy of such
complaint shall be forwarded to the Director-General, International Labour
Organisation Office.
(2) It shall be the duty of the director to—
(a) grant licence subject to such conditions as may be prescribed,
regulate and control the recruitment and placement service and,—
(i) ensure that no fees or other charges for recruitment or
placement of seafarers are borne directly or indirectly or in whole or
in part, by the seafarers other than the cost of the seafarer obtaining a
national statutory medical certificate, the national seafarer’s book and
a passport or other similar personal travel documents, not including,
however, the cost of visas, which shall be borne by the ship owner;
(ii) ensure that adequate machinery and procedures exist for the
investigation, if necessary, of complaints concerning the activities of
recruitment and placement services; and
(iii) to maintain registers of seafarers in respect of the categories
of seafarers;
(b) inspect and verify the books of account and financial documents of
the recruitment and placement service provider and maritime training institute
approved under this Act as and when directed by the Director-General;
(c) perform such duties of the shipping master as the Director-General
may by order direct.
(3) It shall be the duty of the seafarer’s welfare officer—
(a) in the case of any officer appointed at any port in India, to perform
such functions in relation to welfare of seafarers as may be assigned to him
by the Central Government;
Duties of
shipping master,
director and
seafarer’s
welfare officer.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 25
Minimum age
for seafarers.
Medical
certificate.
Training and
qualifications.
Recruitment
and placement
of seafarers.
(b) in the case of any officer appointed at any port outside India, to
perform such functions in relation to welfare of seafarers and such functions
of an Indian ambassador as may be assigned to him by the Central
Government and such functions shall have the same effect as if they had
been performed by an Indian ambassador for the purposes of this Part.
(4) The shipping master or the director or the seafarer’s welfare officer shall
also perform such other duties as the Central Government may, by general or
special order, specify in this behalf.
59. No person under the age of sixteen years shall be engaged, employed or
work onboard any vessel.
60. No person shall engage or carry to sea any seafarer to work in any
capacity in any vessel, unless the seafarer is in possession of a certificate to the
effect that he is medically fit to be employed in that capacity granted in such form
and by such authority as may be prescribed.
61. (1) The Central Government may, by order, direct that the seafarers
generally or any category of seafarers in particular shall not be engaged or carried
to sea to work in any capacity in any vessel or in any class of vessels specified in
the said order, unless each one of them possesses such qualifications as may be
specified by the Director-General, in accordance with the Safety Convention and
Standards of Training, Certification and Watchkeeping for Seafarers Convention.
(2) The ship owner shall ensure that the seafarers shall not work on the
vessel unless they are trained or certified as competent or otherwise qualified to
perform their duties and have successfully completed training for personal safety
onboard vessel.
(3) The training and certification under sub-section (2), shall be in
accordance with the mandatory instruments adopted by the International
Maritime Organisation.
62. (1) The seafarer shall be engaged only by,—
(a) the recruitment and placement service agency possessing the
licence granted under this Part; or
(b) the owners in the case of Indian vessel for the vessel owned by
them.
(2) No person,—
(a) other than an owner of Indian vessel in respect of the vessel owned
by him, shall carry on the business of recruitment and placement service,
unless he is in possession of a valid licence granted under this Part;
(b) shall engage any seafarer under this Act in any vessel unless the
seafarer is in possession of a continuous discharge certificate and seafarer’s
identity documents issued under this Part except as otherwise exempted;
(c) shall demand or receive, either directly or indirectly from any
seafarer or person seeking onboard training or employment as seafarer or
any person on his behalf, any remuneration or fees or other charges for
seafarer recruitment or placement or for providing onboard training or
employment to seafarer or person seeking onboard training or employment
as seafarer:
Provided that the cost of obtaining a medical certificate, the
continuous discharge certificate or identity document and a passport or
other similar personal travel documents by the seafarer may be borne by the
seafarer or any person on his behalf but not including the cost of visas,
which shall be borne by the ship owner;
26 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(d) shall discriminate between seafarers as regards their recruitment
and engagement onboard any vessel,—
(i) on the ground of their membership or lack of membership in
any particular union purporting to represent the interests of seafarers;
(ii) on the basis of training institute from where they obtained
the training or the place of grant of their continuous discharge
certificates.
(3) The Central Government or any officer authorised by it in this behalf, if
satisfied that in the national interest or in the interest of seafarer, it is necessary so
to do, may, by order in writing, prohibit the master or ship owner or his agent
other than of an Indian vessel specified in the order, from engaging any person to
serve as a seafarer on such vessel.
(4) The services of the seafarer engaged in contravention of sub-section (1)
shall not be recognised for the purposes of certification under Part IV.
(5) The Director-General may suspend or withdraw the continuous discharge
certificate or certificate of competency or the certificate of proficiency of a
seafarer who seeks or obtains employment as a seafarer in violation of sub-section (1)
and clause (a) of sub-section (2), with his own knowledge:
Provided that no order for suspension or withdrawal of any certificate shall be
passed unless the seafarer has been given a reasonable opportunity of being heard.
(6) Every recruitment and placement service agency possessing the licence
granted under this Part shall,—
(a) ensure that the ship owner has the financial ability to repatriate
abandoned seafarers;
(b) ensure that the ship owner repatriates abandoned seafarers along
with their maintenance and required medical assistance before such
repatriation;
(c) in case of death, transport the mortal remains of a deceased
seafarer;
(d) ensure that the labour conditions on the vessel where the seafarer
is placed are in conformity with the seafarer’s employment agreement;
(e) ensure that any incident onboard the vessel causing injury,
disappearance or death, is reported within twenty-four hours of receipt of
such information to such authority, in such form and manner as may be
prescribed;
(f) ensure that reports in relation to seafarers recruited or placed
through the recruitment and placement service agency, including any
change in the terms and conditions of the recruitment and placement, are
submitted to such authority, in such form and manner within such time as
may be prescribed;
(g) undertake such other responsibilities as may be prescribed.
63. (1) The master or owner of every Indian vessel or recruitment and
placement service agency for Indian vessel or foreign vessel shall enter into seafarers’
employment agreement in such form and manner as may be prescribed with every
seafarer whom he engages and shall submit a copy thereof to the shipping master.
(2) Notwithstanding anything contained in any other provisions of this Act,
the master of an Indian vessel registered at a port outside India, or owner of such
vessel or his agent who has an agreement with the seafarer made in due form
according to the law of that port or of the port in which her seafarer is engaged,
may engage in any port in India—
Agreement with
seafarers.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 27
s.
s of rest.
ement to
riation.
pensation
ssel’s
r
ering.
(a) a seafarer who is not a citizen of India and who holds a continuous
discharge certificate or any other similar document of identity issued by the
competent authority of the State in which the vessel is registered or, of the
State in which the said agreement was made; or
(b) a seafarer who is a citizen of India and who holds a continuous
discharge certificate granted under this Act,
and any seafarer so engaged under clause (a) or clause (b) may sign the
agreement aforesaid.
(3) A seafarer shall, before signing a seafarers’ employment agreement, be
given an opportunity to examine and seek advice on the agreement to ensure that
he has freely entered into an agreement with sufficient understanding of his rights
and responsibilities.
64. (1) Every ship owner of an Indian vessel shall ensure that full payments
due to seafarers are made to them at not later than monthly intervals and are
given a monthly account of payments due and amounts paid, including wages and
additional payments.
(2) If any amount in respect of wages payable to a seafarer under a seafarer
employment agreement is not paid within the monthly interval, the seafarer shall
be entitled to wages at the rate last payable under the seafarers’ employment
agreement for every day on which it remains unpaid until the full amount is paid,
along with interest at such rate as may be prescribed but no interest shall be
payable if the failure to make such monthly payment was due to—
(a) a reasonable mistake; or
(b) a reasonable dispute as to liability; or
(c) the act or default of the seafarer; or
(d) any other cause not being the wrongful act or default of the persons
liable to make the payment or of their servants or agents.
65. Every ship owner shall ensure that every seafarer in his employment is
given such hours of rest as may be prescribed.
66. Every ship owner of an Indian vessel shall ensure that seafarers are
allowed paid annual leave subject to such conditions as may be prescribed.
67. (1) Seafarers shall have the right to be repatriated at no cost to themselves in
such circumstances and subject to such conditions as may be prescribed.
(2) Every ship owner of an Indian vessel shall provide such financial security to
ensure that seafarers are duly repatriated in such manner as may be prescribed.
(3) When the service of a seafarer is terminated without the consent of the
seafarer at a port outside India before the expiration of the period for which the
seafarer was engaged, the master, ship owner or his agent shall, in addition to any
other related obligation imposed on either of them by this Act, make adequate
provision for the maintenance of the seafarer according to his rank or rating, and
for the return of that seafarer to a proper return port.
(4) If the master, ship owner or his agent fails to repatriate seafarers, the
expenses of maintenance and of the journey to the proper return port shall, if
defrayed by the seafarer, be recoverable as wages due to him, and if defrayed by
an Indian ambassador, shall constitute a debt due to the Central Government in
accordance with the provisions of sub-section (3) or sub-section (4) of section 91.
68. In case of loss or foundering of any vessel, the ship owner shall pay to
each seafarer onboard such indemnity against unemployment resulting from such
loss or foundering, as may be prescribed.
28 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
69. Every vessel shall employ such number of seafarers, as may be
prescribed, onboard to ensure that vessels are operated safely and efficiently with
due regard to security under all conditions, taking into account concerns about
seafarer’s fatigue and the particular nature and conditions of the voyage.
70. Every ship owner shall provide and maintain such accommodations and
recreational facilities for seafarers working or living onboard, or both, consistent
with promoting the seafarer’s health and well-being, as may be prescribed.
71. (1) Every ship owner shall provide for food and drinking water having
quality, nutritional value and quantity that adequately covers the requirements of
the seafarers and takes into account the differing cultural and religious background.
(2) Seafarers onboard a vessel shall be provided with food and water free of
charge during the period of engagement.
(3) The ship owner shall ensure that the seafarers who are engaged as cooks
of the vessel are trained, qualified and found competent as specified by the
Director-General.
72. It shall be the duty of the ship owner to take such measures for
providing protection of health and medical care, at no cost to seafarers employed
onboard the vessel, as may be prescribed.
73. (1) The ship owner shall ensure that seafarers employed on the vessels are
provided with a right to material assistance and support with respect to the financial
consequences of sickness, injury or death occurring while serving under a seafarers’
employment agreement or arising from their employment under such agreement.
(2) Nothing contained in sub-section (1) shall affect any other legal remedy
available to a seafarer under any other law for the time being in force.
74. Every ship owner shall ensure that seafarers working onboard the vessel
are provided with occupational health protection and they live, work and train
onboard vessel in a safe and hygienic environment, in accordance with such
guidelines as the Director-General may by order, specify.
75. All seafarers shall have access to such branches of social security
protection as may be prescribed.
76. (1) The Central Government shall, for the purposes of giving effect to
the provisions of Part A of the Code of the Maritime Labour Convention relating
to flag State responsibilities, make rules for all or any of the following matters,
namely:—
(a) establishing an effective system for inspection and certification of
maritime labour conditions;
(b) authorise public institutions or other organisations competent to
carry out inspections or grant certificates;
(c) effective and coordinated system of regular inspections, monitoring
and other control measures;
(d) onboard complaint procedure for the fair, effective and expeditious
hearing of seafarer’s complaint alleging breach of the Maritime Labour
Convention; and
(e) compliance and enforcement.
(2) The Central Government shall, by order, specifiy such Indian vessels
which shall carry and maintain Declaration of Maritime Labour Compliance.
Manning levels.
Accommodation
and recreational
facilities.
Food and
catering.
Medical care.
Ship owners’
liability.
Health and
safety protection
and accident
prevention.
Social security.
Flag State
responsibilities.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 29
Port State
esponsibilities.
Rules for
nforcement of
Maritime
Labour
Convention.
Payment of
wages.
77. (1) The Central Government shall, for the purposes of giving effect to
the provisions of Part A of the Code of the Maritime Labour Convention relating
to port State responsibilities, make rules for all or any of the following matters,
namely:—
(a) establishing an on shore complaint redressal procedure;
(b) establishing a procedure for inspections in port;
(c) compliance and enforcement.
(2) The Director-General shall notify a system for inspection of vessels and
the procedure for port State inspections, including—
(a) the requirement to develop, maintain and update an electronic
inspection database, containing all information required for implementation
of an effective and coordinated system of regular inspections; and
(b) specifying risk profile of all vessels calling at Indian ports in the
inspection database.
78. (1) The Central Government shall, for the purposes of giving effect to
the provisions of Part A of the Code of the Maritime Labour Convention, make
rules for all or any of the following matters, namely:—
(a) minimum age;
(b) medical certificate;
(c) training and qualifications;
(d) recruitment and placement;
(e) seafarers’ employment agreements;
(f) payment of wages;
(g) hours of work and hours of rest;
(h) entitlement to leave;
(i) repatriation;
(j) compensation in case of loss of vessel or foundering;
(k) manning levels;
(l) service conditions including skill development opportunities;
(m) accommodation, recreational facilities, food and catering;
(n) ship owners’ liability;
(o) health protection, medical facilities, welfare and social security
protection;
(p) any other matter which is to be or may be required for compliance
and enforcement of the Maritime Labour Convention.
(2) The Central Government may, for the purposes of giving effect to,
Part B of the Code of the Maritime Labour Convention and any other provision of
the Maritime Labour Convention which has not been given effect to in this Act,
make rules for all or any of the matters specified in sub-section (1).
79. (1) Where the service of any seafarer engaged under this Act is
terminated before the date specified in the agreement by reason of the wreck, loss
or abandonment of the vessel or by reason of his being left on shore at any place
outside India under a certificate granted under this Act of his unfitness or
inability to proceed on the voyage, the seafarer shall be entitled to receive wages
on such terms and conditions, including the periods during which such seafarer
shall not be entitled to wages, as may be prescribed.
30 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(2) Subject to such exceptions as may be prescribed, a seafarer shall not be
disentitled to claim wages for any period during which he has not performed his duty,
if he proves that he was incapable of doing so by reason of illness, hurt or injury.
(3) If a seafarer having signed an agreement is discharged otherwise than in
accordance with the terms thereof, without fault on his part justifying the discharge
and without his consent, he shall be entitled to receive from the master or ship owner
or his agent, in addition to any wages which he may have earned, as due
compensation for the damage caused to him by the discharge, such sum as the
shipping master may fix having regard to the circumstances relating to the discharge,
which may be recovered as wages.
(4) The compensation so payable under sub-section (3) shall not exceed—
(a) in the case of a seafarer who has been discharged before the
commencement of a voyage, one month’s wages; and
(b) in the case of a seafarer who has been discharged after the
commencement of a voyage, three month’s wages.
80. (1) A seafarer serving in an Indian vessel shall, on termination of his
engagement, be discharged in such manner as may be prescribed.
(2) If an Indian vessel is transferred or disposed of while she is at sea or
on a voyage to any port outside India, every seafarer belonging to that vessel
shall be discharged at that port, unless he consents in writing to complete the
voyage in the vessel, if continued.
(3) If a seafarer is discharged from an Indian vessel without his consent
and before the expiration of the period for which the seafarer was engaged, he
shall be duly repatriated in accordance with the provisions of section 67.
(4) Every seafarer discharged in terms of sub-section (2) shall, if the voyage for
which he was engaged is not continued, be entitled to the wages to which he would
have been entitled had his service been wrongfully terminated by the ship owner
before the expiration of the period for which the seafarer was engaged.
(5) The master of an Indian vessel shall not,—
(a) discharge a seafarer before the expiration of the period for
which he was engaged, unless the seafarer consents to his discharge; or
(b) except in circumstances beyond his control, leave a seafarer behind,
without the authority of the officer specified in this behalf by the Central
Government and such officer shall certify on the agreement with seafarer that
he has granted such authority, and also the reason for the seafarer being
discharged or the seafarer being left behind:
Provided that such officer shall, before discharging or leaving behind such
seafarer, investigate the grounds on which the seafarer is to be discharged or left
behind and may in his discretion grant or refuse to grant such authority:
Provided further that he shall not refuse to grant his authority if he is
satisfied that the seafarer, without reasonable cause,—
(a) has failed or refused to join his vessel or to proceed to sea therein; or
(b) has been absent from his vessel without leave, either at the
commencement or during the progress of a voyage for a period of more than
forty-eight hours.
(6) The officer referred to in clause (b) of sub-section (5) shall keep a
record of all seafarers discharged or left behind with his authority and whenever
any charge is made against a seafarer under section 98, the fact that no such
authority is so recorded shall be prima facie evidence that it was not granted.
Discharge of
seafarers.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 31
Wages and
roperty of
deceased
eafarers and
eafarers left
ehind.
Certain
undisbursed
mounts to be
utilised for
welfare of
eafarers.
Shipping
master to
djudicate
disputes
nvolving
eafarer.
Power of
hipping
master to
equire
roduction of
documents.
Wages not
ecoverable
utside India
n certain
ases.
Summary
roceedings
or wages.
Restrictions on
uits for
wages.
81. If any seafarer is left behind or lost overboard or is deceased, the master
shall enter in the official logbook a statement of the amount due to the seafarer in
respect of wages at the time when he was left behind or lost overboard or is deceased,
and of all property left onboard by him, and shall take such property into his charge
and discharge the property in such manner as may be prescribed.
82. Any amount deposited with or recovered by the shipping master as wages
or for making payment in accordance with the allotment note made by a seafarer or
for being paid to a seafarer or his nominee may, if such amount remains unclaimed
with the shipping master for a period of not less than six years, be utilised for the
welfare of seafarer in such manner and subject to such restrictions and conditions as
may be prescribed.
83. (1) Where under the agreement with the seafarer any dispute arises
between the master, ship owner or his agent and any of the seafarer of the vessel,
it shall be submitted to the shipping master.
(2) Any dispute of an Indian seafarer, on a vessel registered in a State other
than India, in the territorial waters of India, with the master or ship owner or his
agent, may be submitted to the shipping master.
(3) The shipping master shall hear and after giving the parties an
opportunity to be heard, decide the dispute submitted under sub-section (1) or
sub-section (2), pass an award in writing containing reasons, within a period of
thirty days which shall be conclusive as to the rights of parties and any document
relating to such dispute or award itself shall be prima facie evidence thereof:
Provided that if the shipping master does not pass an award within thirty
days from the date of receipt of the dispute for sufficient cause, the shipping
master may pass an award within a further period of thirty days.
(4) The award passed by the shipping master shall be enforceable in
accordance with the provisions of the Code of Civil Procedure, 1908 in the same
manner as if it were a decree of court.
(5) Nothing in the Arbitration and Conciliation Act, 1996 shall apply to any
matter submitted to a shipping master for decision under this section.
84. In any proceedings under this Act before a shipping master relating to the
wages, claims or discharge of a seafarer, the shipping master may require the ship
owner or his agent, master or seafarer to produce any logbooks, papers, or other
documents in his possession or in his power relating to any matter in question in the
proceedings, and may require the attendance of and examine any of those persons.
85. Where a seafarer is engaged for a voyage which is to terminate in India, he
shall not be entitled to sue in any court outside India for wages unless he is discharged
with such sanction as is required by this Act and with the written consent of the master,
or proves such ill-usage on the part, or by the authority, of the master, as to warrant a
reasonable apprehension of danger to his life if he were to remain onboard.
86. (1) A seafarer or a person duly authorised by him, as soon as any wages due
to him become payable but not paid, may apply to any Judicial Magistrate of the first
class exercising jurisdiction in or near the place at which his service has terminated or
at which he has been discharged, or at which any person upon whom the claim is
made is or resides, and such Magistrate shall try the case summarily and the order
made by such Magistrate in the matter shall be final.
(2) An application under sub-section (1) may also be made by any officer
authorised by the Central Government in this behalf by general or special order.
87. A proceeding for the recovery of wages due to a seafarer shall not be
instituted by or on behalf of any seafarer in any civil court except where,—
(a) the ship owner has been declared insolvent;
(b) the vessel is under arrest or sold by the authority of any court; or
(c) a Judicial Magistrate of the first class refers a claim to the court.
5 of 1908.
22 of 1996.
32 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
5 of 1908.
47 of 2023.
5 of 1908.
45 of 2023.
88. (1) The master of a vessel shall, so far as the case permits, have the same
rights, liens and remedies for the recovery of his wages as a seafarer has under
this Act or by any law or custom.
(2) Every master shall have the same rights, liens and remedies for the
recovery of disbursements or liabilities properly made or incurred by him on
account of the vessel as such master has for the recovery of his wages.
(3) Every person lawfully acting as master of a vessel by reason of the
disease or incapacity from illness, of the master of such vessel shall, so far as the
case permits, have the same rights, liens and remedies for the recovery of
disbursements or liabilities properly made or incurred by him on account of the
vessel as a master has for the recovery of his wages.
89. (1) Where the Central Government is of the opinion that any dispute
between seafarer or any class of seafarers or of any union of seafarers and the ship
owners in which such seafarers are employed or are likely to be employed exists
or is apprehended and such dispute relates to any matter connected with or
incidental to the employment of the seafarers, the Central Government may, by
notification, constitute a Tribunal consisting of one or more persons, having such
qualifications and experience as may be prescribed including having knowledge
of maritime matter, and refer the dispute to the Tribunal for adjudication.
(2) The Tribunal shall not be bound by the procedure laid down by the Code
of Civil Procedure, 1908 but shall be guided by the principles of natural justice.
(3) The Tribunal shall also not be bound by the rules of evidence contained
in the Bharatiya Sakshya Adhiniyam, 2023.
(4) The Tribunal shall, for the purposes of discharging its functions under
this Act, have power to regulate its own procedure and shall have the same powers
as are vested in a civil court under the Code of Civil Procedure, 1908, while trying
a suit in respect of the following matters, namely:—
(a) summoning and enforcing the attendance of any person and
examining him on oath;
(b) compelling the production of documents;
(c) receiving evidence on affidavits;
(d) issuing commissions for the examination of witnesses;
(e) any other matter which is required to be or may be prescribed.
(5) Any proceeding before the Tribunal shall be deemed to be a judicial
proceeding within the meaning of section 229 and section 267 of the Bharatiya
Nyaya Sanhita, 2023.
(6) No party to a dispute shall be entitled to be represented by a legal
practitioner in any proceeding before the Tribunal except with the consent of the
other party or parties to the proceeding and with the leave of the Tribunal.
(7) The Tribunal shall dispose of the reference and submit its award to the
Central Government within such period as may be prescribed.
(8) On receipt of the award, the Central Government shall cause it to be
published and the award shall become enforceable on the expiry of thirty days
from the date of such publication:
Provided that where the Central Government is of the opinion that it shall
be inexpedient on the grounds of public interest to give effect to the award or any
part of it, it may, before the expiry of the said period of thirty days by order in the
Official Gazette, either reject the award or modify it, and where the Central
Government does so, the award shall not become enforceable or shall become
enforceable subject to such modifications.
Remedies of
master for
wages,
disbursements,
etc.
Power to refer
disputes
between
seafarers and
employers to
Tribunal.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 33
Recovery of
wages, etc., of
seafarers lost
with vessel.
Relief and
maintenance of
abandoned
seafarers.
(9) An award which has become enforceable under this section shall be
binding on—
(a) all parties to the dispute;
(b) where any party to the dispute is the ship owner, his heirs,
successors, or assignees.
(10) Save as otherwise provided in the award, an award shall remain in
operation for a period of one year from the date on which it becomes enforceable
and shall thereafter continue to remain in operation until a period of two months
has elapsed from the date on which notice is given by any party bound by the
award to the other party or parties intimating its intention to terminate the award.
(11) Unless otherwise directed by the Central Government, the Tribunal
shall cease to exist on the expiry of a period of thirty days after publication of the
award.
(12) Any money due to a seafarer from the ship owner under an award may
be recovered as wages.
(13) Nothing contained in the Industrial Disputes Act, 1947 shall apply to
any dispute between seafarers or any class of seafarers or any union of seafarers
and the ship owners in respect of the ship in which such seafarers are employed
or are likely to be employed.
(14) During the pendency of proceedings under this section,—
(a) no seafarer or class of seafarers or union of seafarers shall go or
remain on strike or otherwise act in a manner prejudicial to the normal
operation of the vessels in which the seafarer is employed or is likely to be
employed; and
(b) no ship owner shall,—
(i) alter to the prejudice of the seafarers concerned in the dispute,
the conditions of service applicable to them immediately before the
commencement of such proceedings; or
(ii) discharge or punish any seafarer in respect of any matter
connected with the dispute.
90. Where a seafarer is missing or lost with the vessel to which he belongs,
the Central Government or such officer as the Central Government may appoint
in this behalf may recover the wages and the compensation due to him from the
master or ship owner or his agent in the same court and in the same manner in
which the seafarer’s wages are recoverable, and shall deal with those wages in the
same manner as with the wages and compensation due to other deceased seafarers
under this Act.
91. (1) The Indian ambassador at or near the place where a seafarer is
abandoned shall, on an application being made to him by the abandoned seafarer,
provide in accordance with the rules made under this Act for the return of that
seafarer to a proper return port and also for his necessary clothing and
maintenance until his arrival at such port.
(2) An abandoned seafarer shall not have any right to be maintained or sent
to a proper return port except to the extent and subject to such conditions as may
be prescribed.
(3) All repatriation expenses, other than excepted expenses, incurred by or
on behalf of the Central Government in accordance with the provisions of this Act
shall constitute a debt due to the Central Government for which the ship owner or
his agent or the vessel to which the seafarer in respect of whom they were incurred
belonged at the time of his discharge or other event which resulted in his becoming
an abandoned seafarer shall be liable, and the ship owner or his agent shall not be
4 of 1947.
34 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
entitled to recover from the seafarer any amount paid by him to the Central
Government in settlement or part settlement of such debt.
(4) All excepted expenses incurred by or on behalf of the Central
Government in accordance with the provisions of this Act shall constitute a debt
due to the Central Government for which the seafarer in respect of whom they
were incurred and the ship owner or his agent or the vessel to which that seafarer
belonged at the time of his discharge or other event which resulted in his becoming
an abandoned seafarer shall be jointly and severally liable, and the ship owner or
his agent shall be entitled to recover from the seafarer any amount paid by him to
the Central Government in settlement or part settlement of such debt, and may
apply to the satisfaction of his claim so much as may be necessary of any wages
due to the seafarer.
(5) All excepted expenses incurred in accordance with the provisions of this
Act in respect of any abandoned seafarer by the ship owner or his agent or the
vessel to which he belonged at the time of his discharge or other event which
resulted in his becoming an abandoned seafarer shall constitute a debt due to the
ship owner or his agent for which the seafarer shall be liable, and the ship owner
or his agent may apply to the satisfaction of his claim so much as may be necessary
of any wages due to the seafarer but he shall not be entitled to recover from the
seafarer any repatriation expenses other than excepted expenses.
(6) In any proceedings for the recovery of any expenses which in terms of
sub-section (3) or sub-section (4) are a debt due to the Central Government, the
production of an account of the expenses and proof of payment thereof by or on
behalf of or under the direction of the Central Government shall be prima facie
evidence that the expenses were incurred in accordance with the provisions of this
Act by or on behalf of the Central Government.
(7) Any debt which may be due to the Central Government under this section
may be recovered by any officer authorised by it in writing in this behalf from the
person concerned in the same manner as the wages are recoverable under
section 86.
Explanation.—For the purposes of this section,—
(a) “excepted expenses” means repatriation expenses incurred in cases
where the cause of the seafarer being left behind is desertion or absence
without leave or imprisonment for misconduct or discharge from his vessel
on the grounds of misconduct;
(b) “repatriation expenses” means expenses incurred in returning an
abandoned seafarer to a proper return port and in providing him with
necessary clothing and maintenance until his arrival at such port, and
includes in the case of a shipwrecked seafarer, the repayment of expenses
incurred in conveying him to a port after shipwreck and maintaining him
while being so conveyed;
(c) “shipping master” means a shipping master,—
(i) for the port at which the seafarer entered into, or is believed
to have entered into, an agreement; or
(ii) where the seafarer did not enter into an agreement in India,
for the port to which the seafarer has returned, or is expected to
return, on the completion of his latest voyage.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 35
Replacement
crew onboard
abandoned
vessels.
Inspection by
shipping master,
etc.
92. (1) If the ship owner of any abandoned Indian vessel or any foreign
vessel abandoned on or near the coast of India or within its coastal waters fails to
make arrangement for or to meet the cost of arranging for replacement crew to be
sent onboard the vessel whose seafarers are required to be repatriated, the Central
Government shall arrange for replacement crew to be sent onboard such vessel.
(2) The cost incurred by or on behalf of the Central Government under
sub-section (1) shall constitute a debt due to the Central Government liable to be
paid by the ship owner or his agent for the seafarer in respect of whom they were
incurred and the ship owner or his agent shall not be entitled to recover from the
seafarer any amount paid by him to the Central Government in settlement or part
settlement of such debt.
(3) In any proceedings for the recovery of any expenses which in terms of
sub-section (2) are a debt due to the Central Government, the production of an
account of the expenses and proof of payment thereof by or on behalf of or under
the direction of the Central Government shall be prima facie evidence that the
expenses were incurred in accordance with the provisions of this Act by or on
behalf of the Central Government.
(4) Any debt which may be due to the Central Government under this section
may be recovered by any officer authorised by it in writing in this behalf from the
person concerned in the same manner as the wages are recoverable under
section 86.
(5) In any proceeding under this Part, a certificate of the Central
Government or of such officer as the Central Government may specify in this
behalf, to the effect that any seafarer named therein is abandoned, shall be
conclusive evidence that such seafarer is an abandoned seafarer within the
meaning of this Act.
93. (1) A shipping master, surveyor, seafarer’s welfare officer, Indian
ambassador or any other officer at any port duly authorised in this behalf by the
Central Government shall, at any time,—
(a) in the case of any vessel upon which the seafarer has been shipped
at that port; and
(b) in the case of any Indian vessel, and if the master or three or more
of the seafarers so request,
enter onboard the vessel and inspect,—
(i) the provisions and water;
(ii) the weights and measures;
(iii) the accommodation for seafarers,
with which the vessel is required to be provided by or under this Act and also the
space and equipment used for the storage and handling of food, water and the
galley and other equipment used for the preparation and service of meals;
(iv) the Maritime Labour Certificate and Declaration of Maritime
Labour Compliance.
(2) All Indian vessels engaged in international voyage or operating from a
port, or between ports, in another State, shall possess a Maritime Labour
Certificate and a Declaration of Maritime Labour Compliance.
36 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
Explanation.—For the purposes of this sub-section, “international voyage”
means a voyage from or to a port or place in India to or from a port or place outside
India or between any ports outside India.
(3) The vessels not covered under sub-section (2) shall, unless exempted by
the Central Government, possess such certificate in such manner and form as may
be prescribed.
(4) For the purpose of preventing seafarer from being taken onboard any
vessel at any port in India contrary to the provisions of this Act, a shipping master
or deputy shipping master or assistant shipping master or a director, or deputy
director or assistant director of the seafarer’s employment office may enter at any
time, onboard any such vessel upon which he has reasons to believe that seafarers
have been shipped, and may muster and examine the seafarers employed therein.
Explanation.—For the purposes of this section, “Maritime Labour
Certificate” means a certificate granted by the Central Government or by any
officer, authority or organisation authorised by it in this behalf, in accordance with
the provisions of the Maritime Labour Convention.
94. (1) A seafarer shall for the purposes of this Part, be deemed to be a
serving seafarer during any period commencing on the date of the agreement with
seafarers and ending thirty days after the date on which the seafarer is finally
discharged from such agreement.
(2) Every seafarer who is a party to a litigation shall be protected to the
extent, subject to such terms and conditions and in such manner, as may be
prescribed.
95. If a seafarer states to the master that he desires to make a complaint to a
Judicial Magistrate of the first class or other proper officer against the master or
any of the seafarers, the master shall,—
(a) if the vessel is then at a place where there is a Judicial Magistrate
of the first class or other proper officer, as soon after such statement as the
service of the vessel shall permit; and
(b) if the vessel is not then at such place, as soon after her first arrival
at such place as the service of the vessel shall permit,
allow the complainant to go ashore or send him ashore under proper protection to
enable him to make the complaint.
96. Where a vessel has arrived at a port or place in India at the end of a
voyage and any person, not being in the service of the Government or not being
duly authorised by law for the purpose, goes onboard the vessel without the
permission of the master, the master may take such person into custody and
deliver him up forthwith to a police officer to be taken before a Judicial Magistrate
of the first class and dealt with according to the provisions of this Act.
97. No seafarer belonging to an Indian vessel wherever it may be, or to any
other vessel while in India, shall knowingly,—
(a) do anything tending to the immediate loss or destruction of, or
serious damage to, the vessel, or tending immediately to endanger the life
of, or to cause injury to any person belonging to or onboard the vessel; or
(b) refuse or omit to do any lawful act proper and requisite to be done
by him for preserving the vessel from immediate loss, destruction or serious
damage, or for preserving any person belonging to or onboard the vessel
from danger to life or from injury.
Special
provisions for
protection of
seafarers in
respect of
litigation.
Facilities for
making
complaint.
Vessel not to be
boarded without
permission.
Misconduct
endangering life
or vessel.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 37
Desertion and
absence without
leave.
98. (1) No seafarer lawfully engaged shall,—
(a) desert his vessel; or
(b) neglect or refuse, without reasonable cause, to join the vessel or
proceed to sea in his vessel or be absent without leave at any time within
twenty-four hours of the vessel’s sailing from a port either at the
commencement or during the progress of a voyage, or be absent at any time
without leave and without sufficient reason from his vessel or from his duty.
(2) For the purposes of sub-section (1), the fact that the vessel on which the
seafarer is engaged or to which he belongs is unseaworthy, shall be deemed to be
a reasonable cause for desertion or absence without leave:
Provided that the seafarer has, before failing or refusing to join his vessel or
to proceed to sea in his vessel or before absenting himself or being absent from
the vessel complained to the master or a shipping master, surveyor, seafarer’s
welfare officer, port health officer, Indian ambassador or any other officer at any
port duly authorised in this behalf by the Central Government, that the vessel is
unseaworthy.
(3) If it is shown to the satisfaction of a shipping master that a seafarer has
deserted his vessel or has absented himself without leave and without sufficient
reason from his vessel or from his duty, the shipping master shall forthwith make
a report to that effect to the Director-General who may thereupon direct that the
seafarer’s continuous discharge certificate and seafarer identity document shall be
withheld for such period as may be specified in that direction, or may suspend or
withdraw the certificate of competency or certificate of proficiency of the
deserting seafarer, if it is established that such desertion was without leave or
sufficient reason:
Provided that no order of withholding, suspension or cancellation shall be
passed unless the seafarer has been given an opportunity of being heard.
(4) If a seafarer deserts his vessel or is absent without leave and without
sufficient reason from his vessel or from his duty, the master, any seafarer, the
ship owner or his agent may, without prejudice to any other action that may be
taken against the seafarer under this Act, convey him onboard his vessel and may
for that purpose cause to be used such force as may be reasonable in the
circumstances of the case.
(5) If, either at the commencement or during the progress of any voyage, a
seafarer engaged in an Indian vessel commits outside India, the offence of
desertion or absence without leave or any offence against discipline, the master
or the ship owner or his agent may, if and so far as the laws in force in the place
permit, arrest him without procuring a warrant.
(6) No person shall convey onboard or arrest a seafarer on improper or
insufficient grounds.
(7) Where a seafarer is brought before a court on the ground of desertion or
of absence without leave or of any offence against discipline, and the master or
the ship owner or his agent so requires, the court may, in lieu of committing and
sentencing him for the offence, cause him to be conveyed onboard his vessel for
the purpose of proceeding on the voyage, or deliver him to the master or the ship
owner or his agent to be by them so conveyed, and may in such case order any
costs and expenses properly incurred by or on behalf of the master or ship owner
by reason of the conveyance to be paid by the offender and, if necessary, to be
deducted from any wages which he has then earned or by virtue of his then
existing engagements may afterwards be earned.
38 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
99. (1) Any seafarer lawfully engaged shall be liable to penalty or be guilty
of an offence under this Act, if he commits any of the following acts, namely:—
(a) if he quits the vessel without leave after her arrival at her port of
delivery and before she is placed in security;
(b) if he has received an advance payment on the basis of his
agreement and wilfully or through misconduct fails to attend his vessel or
desert therefrom before the payment becomes due to him;
(c) if he wilfully disobeys any lawful command or neglects the duty;
(d) if he continues to wilfully disobey any lawful commands or if he
combines with any of the seafarers to wilfully disobey any lawful
commands, or continues with wilful neglect of duty or if he combines with
any of the seafarer to neglect duty or to impede the navigation of the vessel
or retard the progress of the voyage;
(e) if he assaults the master or any other seafarer belonging to the
vessel;
(f)
if he wilfully damages his vessel or commits criminal
misappropriation or breach of trust in respect of, or wilfully damages any
of, her stores or cargo.
(2) The prosecution against any seafarer for any offence specified under
clauses (d), (e) and (f) of sub-section (1) may be instituted by the Director-General
or an officer authorised by him.
(3) The Director-General may, by order, suspend or cancel any certificate
granted under this Act to any seafarer for any specified period, for any offence
specified in sub-section (1) during the course of the hearing or legal proceeding:
Provided that no order of suspension or cancellation shall be passed unless
the person concerned has been given an opportunity of being heard.
100. (1) If a seafarer engaged is convicted of an offence of smuggling any
goods, whereby loss or damage is occasioned to the master or ship owner, he shall
be liable to pay to that master or ship owner, a sum sufficient to reimburse the loss
or damage and the whole or a part of his wages may be retained in satisfaction on
account of that liability without prejudice to any other remedy.
(2) If a seafarer is convicted of an offence under sub-section (1), the
Director-General may direct that the seafarer’s continuous discharge certificate
and seafarer’s identity document shall be cancelled or suspended for such period
as may be specified in the direction.
101. If any offence of desertion or absence without leave under section 98
or offence against discipline under section 99 is committed, or if any act of
misconduct is committed for which the offender’s agreement imposes a fine and
it is intended to enforce the fine,—
(a) an entry of the offence or act shall be made in the official logbook
and signed by the master and the officer on watch;
(b) the offender, if still in the vessel, shall, before the subsequent
arrival of the vessel at any port, or, if she is at the time in port, before her
departure therefrom, be furnished with a copy of the entry and have the same
read over distinctly and audibly to him and may thereupon make such reply
thereto as he thinks fit;
(c) a statement of a copy of the entry having been so furnished and the
entry having been so read over and the reply, if any, made by the offender
shall likewise be entered and signed in the manner aforesaid; and
General liability
against
discipline.
Smuggling of
goods by
seafarer.
Entry of
offences in
official logbook.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 39
Report of
desertions and
absences
without leave.
Entries and
certificates of
desertion
abroad.
Facilities for
proving desertion
in proceedings
for forfeiture of
wages.
Application of
forfeitures.
Decision of
questions of
forfeiture and
deduction in
suits for wages.
Payment of
fines imposed
under agreement
to shipping
master.
(d) in any subsequent legal proceedings, the entries required by this
section shall, if practicable, be produced or proved, and, in default of such
production or proof, the court hearing the case may in its discretion, refuse
to receive evidence of the offence or act of misconduct.
102. Whenever any seafarer engaged outside India on an Indian vessel
deserts or otherwise absents himself in India without leave, the master of the
vessel shall, within forty-eight hours of discovering such desertion or absence,
report the same to the shipping master or to such other officer as the Central
Government specifies in this behalf, unless in the meantime, the deserter or
absentee returns.
103. (1) In every case of desertion from an Indian vessel whilst such vessel
is at any place out of India, the master shall produce the entry of desertion in the
official logbook to the Indian ambassador at the place, who shall thereupon make
and certify a copy of the entry which shall be admissible in evidence in any legal
proceeding relating to such desertion.
(2) The master shall forthwith transmit such copy of entry certified under
sub-section (1) to the shipping master at the port at which the seafarer was
shipped, and the shipping master shall, if required, cause the same to be produced
in any legal proceeding.
104. (1) Whenever a question arises whether the wages of any seafarer are
forfeited for desertion from a vessel, it shall be sufficient for the person insisting
on the forfeiture to show that the seafarer was duly engaged in or belonged to the
vessel, and either that he left the vessel before the completion of the voyage or
engagement or, if the voyage was to terminate in India and the vessel has not
returned, that he is absent from her and that an entry of his desertion has been duly
made in the official logbook.
(2) The desertion shall thereupon, so far as relate to any forfeiture of wages
under this Part, be deemed to be proved, unless the seafarer produces a proper
certificate of discharge or otherwise show to the satisfaction of the court that he
had sufficient reasons for leaving his vessel.
105. Where any wages or other property are under this Act forfeited for
desertion from a vessel, they shall be applied towards reimbursing the expenses
caused by such desertion to the master or the ship owner or his agent, which may
be recovered by the master, or the ship owner or his agent in the same manner as
the deserter could have recovered them if not forfeited, and subject to that
reimbursement, shall be paid to the Central Government.
106. Any question concerning the forfeiture of or deductions from the wages
of a seafarer may be determined in any proceeding lawfully instituted with respect
to those wages, notwithstanding that the offence in respect of which the question
arises, though by this Act made punishable by imprisonment as well as forfeiture
has not been made the subject of any criminal proceeding.
107. (1) Every fine imposed on a seafarer for any act of misconduct under
his agreement shall be deducted and paid as follows, namely:—
(a) if the offender is discharged at any port or place in India and the
offence and such entries in respect thereof are proved to the satisfaction of
the shipping master, the master or ship owner or his agent shall deduct such
fine from the wages of the offender and pay the same to such shipping
master; and
(b) if the seafarer is discharged at any port or place outside India and
the offence and such entries are proved to the satisfaction of the Indian
40 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
ambassador by whose sanction he is so discharged, the fine shall thereupon
be deducted, and an entry of such deduction shall then be made in the official
logbook, if any, and signed by such officer and on the return of the vessel to
India, the master or ship owner shall pay such fine to the shipping master.
(2) An act of misconduct for which any such fine was imposed and paid
shall not be otherwise punishable under this Act.
(3) The proceeds of all fines received by a shipping master under this section
shall be utilised for the welfare of seafarers in such manner as the Central
Government may direct.
108. No person shall,—
(a) by any means whatever persuade or attempt to persuade a seafarer
to neglect or refuse to join or proceed to sea in or desert from his vessel, or
otherwise to absent himself from his duty;
(b) harbour or secrete a seafarer who has wilfully neglected or refused
to join or has deserted from his vessel, knowing or having reason to believe
the seafarer to have so done:
Provided that the provisions of this clause shall not extend to the case in
which the harbour or secreting is by the spouse of the seafarer.
109. No person shall secrete himself and go to sea in a vessel without the
consent of either the master or the ship owner or his agent or of the person in
charge of the vessel or of any other person entitled to give that consent.
110. (1) If, during the progress of a voyage the master of any Indian vessel
is removed or superseded or for any other reason quits the vessel and is succeeded
in the command by some other person, he shall deliver to his successor documents
relating to navigation of the vessel and the seafarers thereof which are in his
custody.
(2) On receipt of documents under sub-section (1), the successor shall make
an entry in the official logbook to that effect which shall also be endorsed by the
predecessor.
(3) The Director-General may suspend or withdraw the certificate of
competency of a master, if it is established that the documents were not lawfully
handed over in accordance with sub-section (1), without leave or sufficient
reason:
Provided that no order for suspension or withdrawal of any certificate shall
be passed unless the master has been given a reasonable opportunity of being
heard.
111. (1) Where it appears to the Central Government that due facilities are
or shall be given by the Government of any State outside India for recovering and
apprehending seafarers who desert from Indian vessels in that State, the Central
Government may, by notification, stating that such facilities are or shall be given,
declare that this section shall apply to seafarers belonging to vessels of such State,
subject to such limitations or conditions as may be specified in the notification.
(2) Where this section applies to seafarers belonging to vessels of any State
other than India and a seafarer deserts from any such vessel, when within India,
any court that would have taken cognizance of the matter if the seafarer had
deserted from an Indian vessel shall, on an application of the ambassador of that
State, aid in apprehending the deserter and for that purpose may, on information
given on oath, issue a warrant for his apprehension and on proof of the desertion,
order him to be conveyed onboard his vessel or delivered to the master or the ship
Seafarer not to
be enticed to
desert.
Stowaways and
seafarers carried
under
compulsion.
On change of
master,
documents to be
handed over to
successor.
Deserters from
foreign vessels.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 41
Official
logbook.
Power to make
rules.
owner or his agent to be so conveyed and any such warrant or order may be
executed accordingly.
112. (1) Every vessel of two hundred tons gross or more shall maintain an
official logbook in such form and such manner as may be prescribed.
(2) The master, ship owner or his agent shall deliver the official logbook
referred to in sub-section (1), to the shipping master as and when required by the
shipping master.
(3) No person shall make or procure to be made or assist in making any entry
in official logbook in respect of any occurrence happening previously to the
arrival of the vessel at her final port of discharge more than twenty-four hours
after such arrival.
113. (1) In addition to the power of the Central Government to make rules
for enforcement of Maritime Labour Convention, the Central Government shall
make rules generally to carry out the provisions of this Part, including rules in
respect of the following matters, namely:—
(a) discharge of seafarers;
(b) payment of wages;
(c) advance and allotment of wages;
(d) rights of seafarers in respect of wages;
(e) mode of recovering wages;
(f) disputes between seafarers and employers;
(g) property of deceased seafarers;
(h) repatriation of seafarers and abandoned seafarers;
(i) provisions, health and accommodation;
(j) special provisions for the protection of seafarers in respect of
litigation;
(k) provisions for the protection of seafarers in respect of other matters;
(l) provisions as to discipline;
(m) official logbooks.
(2) In particular, and without prejudice to the generality of the foregoing power,
such rules may provide for all or any of the following matters, namely:—
(a) the categories and minimum manning scales of seafarers and the
scales for different classes of vessels under sub-section (2) of section 56;
(b) the conditions subject to which vessel shall be in possession of a
certificate under sub-section (2) of section 57;
(c) the form and manner of the grant of continuous discharge
certificate and seafarer’s identity documents under clause (c) of
sub-section (1) of section 58;
(d) the conditions subject to which licence may be granted under
clause (a) of sub-section (2) of section 58;
(e) the form of certificate to be possessed by seafarer and the authority
who grants that certificate to the effect that the seafarer is medically fit under
section 60;
42 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(f) the authority to whom and the form and manner in which the incident
is to be reported under clause (e) of sub-section (6) of section 62;
(g) the authority to whom and the form, manner and the time within which
the reports is to be submitted under clause (f) of sub-section (6) of section 62;
(h) other responsibilities of the recruitment and placement agency
under clause (g) of sub-section (6) of section 62;
(i) the form and manner of seafarer’s employment agreement under
sub-section (1) of section 63;
(j) the rate of interest on the wages payable to a seafarer
under sub-section (2) of section 64;
(k) the hours of rest provided to every seafarer under section 65;
(l) the conditions subject to which seafarers are given annual paid
leave under section 66;
(m) the circumstances and conditions for repatriation of seafarers
under sub-section (1) of section 67;
(n) the financial security and manner of repatriation of seafarers
under sub-section (2) of section 67;
(o) the indemnity amount to be paid to the seafarer under section 68;
(p) the number of seafarers to be employed onboard the vessel
under section 69;
(q) the accommodations and recreational facilities for seafarers
under section 70;
(r) the measures for providing protection of health and medical care to
seafarers under section 72;
(s) the branches of social security protection to seafarers under section 75;
(t) the terms and conditions and the period during which a seafarer
shall not be entitled to wages under sub-section (1) of section 79;
(u) the exceptions where a seafarer shall not be disentitled to claim
wages under sub-section (2) of section 79;
(v) the manner of discharge from service of seafarer under
sub-section (1) of section 80;
(w) the manner of discharge of property under section 81;
(x) the manner and the restrictions and conditions for utilisation of any
unclaimed amount deposited with or recovered by shipping master for the
welfare of seafarers under section 82;
(y) the qualifications and experience of persons appointed to the
Tribunal under sub-section (1) and any other matter under clause (e) of
sub-section (4) of section 89;
(z) the period within which the Tribunal shall submit its award to the
Central Government under sub-section (7) of section 89;
(za) the extent and the conditions subject to which a seafarer shall be
maintained or sent to a proper return port, under sub-section (2) of section 91;
(zb) the manner of possession of certificate and the form of such
certificate under sub-section (3) of section 93;
(zc) the terms, conditions and manner of protecting a seafarer who is
a party to litigation under sub-section (2) of section 94;
(zd) the form and manner of keeping logbook under sub-section (1) of
section 112;
(ze) any other matter which is required to be or may be prescribed.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 43
Application of
this Part.
Definitions.
Safety and
security
requirements.
PART VI
SAFETY AND SECURITY
114. This Part, unless otherwise exempted, shall apply in relation to matters
on safety and security, to—
(a) Indian vessel and other vessels registered in India under this Act,
except vessels covered under Part XIII;
(b) vessel other than Indian vessel when such vessel is within India,
including coastal waters;
(c) port facility; and
(d) company.
115. In this part, unless the context otherwise requires,—
(a) “company” means the owner of the vessel or any other
organisation or person such as the manager, or the bareboat charterer, who
has assumed the responsibility for operation of the vessel from the owner of
the vessel and who on assuming such responsibility has agreed to take over
all the duties and responsibilities imposed by the International Safety
Management Code under the Safety Convention;
(b) the words and expressions used in this Part but not defined, shall
have the meanings respectively assigned to them in the international
conventions or agreements or treaties, including their protocols, referred to
in section 116.
116. (1) Every vessel shall, subject to such conditions as may be prescribed,
comply with the provisions of the following international conventions, treaties or
agreements, as applicable, namely:—
(a) the Safety Convention;
(b) the Load Lines Convention, 1966;
(c) the Special Trade Passenger Ships Agreement, 1971;
(d) the Convention on the International Regulations for Preventing
Collisions at Sea, 1972;
(e)
the International Convention on Maritime Search and
Rescue, 1979;
(f) the Tonnage Measurement Convention, 1969;
(g) the International Convention for Safe Containers, 1972;
(h) such other convention or agreement or treaty relating to safety or
security to which India is a party, as may be notified by the Central
Government:
Provided that vessels to which the provisions of the above conventions,
treaties or agreements are not applicable, shall comply with such safety and
security requirements as may be prescribed:
Provided further that it shall be a defense for the master or ship owner to
prove that a contravention was solely due to deviation or delay caused by stress
of weather or other circumstances which neither the master nor the ship owner
nor the charterer, if any, could have prevented or forestalled.
(2) The safety and security requirements for different classes of vessels and
certificates to be held by such vessels shall be such as may be prescribed.
44 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
117. (1) When an incident relating to the safety and security takes place on
a vessel, the master of the vessel shall report the particulars of the incident to such
authority and in such manner as may be prescribed.
(2) When an incident takes place relating to the loss or likely loss overboard
of dangerous goods in packaged form into the sea, or dangerous goods in solid
form in bulk into the sea, or any incident impeding safe navigation, the master of
every vessel shall report the particulars of the incident to such authority in such
manner as may be prescribed.
(3) If the vessel referred to in sub-section (1) or sub-section (2) is
abandoned, or a report from such vessel is incomplete, the Central Government
shall fix the responsibility on the master of the vessel.
118. (1) The master of an Indian vessel, on receiving at sea a signal of
distress or information from any source that a vessel or aircraft is in distress shall
proceed with all speed to the assistance of the persons in distress informing them,
if possible, that he is doing so unless he is unable or in the special circumstances
of the case considers it unreasonable or unnecessary to do so or unless he is
released from such obligation under the provisions of sub-section (3).
(2) Where the master of any vessel in distress has requisitioned any Indian
vessel that has answered his call, it shall be the duty of the master of the
requisitioned vessel to comply with the requisition by continuing to proceed with
all speed to the assistance of the persons in distress unless he is released from the
obligation under sub-section (4).
(3) The master shall be released from the obligation imposed by
sub-section (1) as soon as he is informed of the requisition of one or more vessels
other than his own and that the requisition is being complied with by the vessel or
vessels requisitioned.
(4) The master whose ship has been requisitioned under sub-section (2) shall
be released from the obligation imposed by that sub-section, on being informed
by the persons in distress or by the master of any vessel which has reached the
person in distress, that assistance is no longer required.
(5) If the master of an Indian vessel, on receiving at sea a signal of distress
referred to in sub-section (1), is unable or in the special circumstances of the case
considers it unreasonable or unnecessary to go to the assistance of the persons in
distress, he shall forthwith cause a statement to be entered in the official logbook
or if there is no official logbook, cause other record to be kept of his reasons for
not going to the assistance of those persons.
(6) The master of every Indian vessel for which an official logbook is
required, shall enter or cause to be entered in the official logbook every signal of
distress or message that a vessel, aircraft or person is in distress at sea.
(7) The master of every Indian vessel shall render assistance to every person
found at sea in danger of being lost, unless he is unable to or, in the special
circumstance of the case, considers that such assistance cannot be rendered
without serious danger to his vessel, or the persons thereon.
(8) If the master of an Indian vessel is unable or consider it unreasonable to
go to the assistance of a person found at sea in danger of being lost, the master
shall forthwith cause a statement to be entered in the official logbook or, if there
is no official logbook, cause other record to be kept of his reasons for not going
to the assistance of that person.
(9) The master of the vessel shall take all reasonable measures to report the
particulars of any incident relating to safety and security which takes place in the
vicinity of the vessel to such authority in such manner as may be prescribed.
Reporting of
incidents.
Obligations to
render
assistance on
receiving signal
of distress and
to persons in
danger.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 45
Search and
rescue services.
Radio
communication
requirements.
Information
about vessel’s
stability.
Submersion of
load lines.
No vessel to
carry passenger
without
certificate.
119. The Central Government shall, whenever necessary, make arrangements
for search and rescue services for dealing with distress situation at sea, including
coastal waters or such territory under the International Convention on Maritime
Search and Rescue, 1979 and agreement related thereto or any other law for the
time being in force.
120. Every Indian vessel shall be equipped and maintained with such
communication equipment, distress and safety equipment and shall be provided
with such certified operators as may be prescribed.
121. (1) Every Indian vessel shall carry onboard such information relating
to the stability of the vessel and the effects of any damage control and general
precautions necessary to maintain watertight integrity of the vessels and
provisions for damage control duly approved, in compliance with the provisions
of the Safety Convention and the Load Line Convention or the safety and security
requirements in accordance with the provisions of this Part.
(2) The chief ship surveyor shall assign load line, in compliance with the
Load Line Convention and approve such information relating to stability of
passenger ships as may be prescribed:
Provided that the Director-General may, by order, authorise any other
surveyor to perform the duties of the chief ship surveyor under this section on
such terms and conditions as may be specified therein.
122. (1) No vessel, other than a vessel exempted from the provisions of this
Part relating to load lines, shall be so loaded as to submerge when the vessel has
no list of the appropriate load line on each side of the vessel, that is to say, the
load line indicating or purporting to indicate the maximum depth to which the
vessel is for the time being entitled under the load line rules, to be loaded.
(2) Without prejudice to any other proceedings under this Act, any vessel
which is loaded in contravention of this section may be detained until such vessel
ceases to be so loaded.
123. (1) No vessel shall carry passengers between ports or places in India or
from any port or place in India to any port or place outside India, or from any port
or place outside India to any port or place in India, unless such vessel has all valid
certificates required under this part.
(2) The Central Government may, by general or special order, specify the
conditions relating to,—
(a) passenger accommodation;
(b) scale of passenger and amenities to be provided to seafarers;
(c) space or disallowance of any space on a vessel;
(d) scale of provisions and water to be provided;
(e) hospital accommodation and medical facilities;
(f) the conditions for carriage of cargo and livestock; and
(g) any other matter, to carry out the purposes of this Part.
(3) Subject to the conditions specified in sub-section (2), the master of a
passenger vessel departing or proceeding on a voyage shall make a statement
about the passengers onboard the vessel in such form as may be specified by the
Central Government in this behalf.
46 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
124. No vessel shall proceed to sea unless such vessel is in possession of
valid certificates referred to in sub-section (2) of section 116.
125. (1) A person shall be liable to penalty under this Act if he commits any
of the following acts, namely:—
(a) being drunk or disorderly attempts to enter a vessel; or
(b) onboard molest any person; or
(c) travels or attempts to travel without payment of fare; or
(d) wilfully refuses or neglects to quit the vessel on arrival at
destination; or
(e) fails to exhibit his ticket when requested by the master or other
officer; or
(f) misconducts himself in such a manner as to cause annoyance or
injury to persons onboard; or
(g) carries any substance that could jeopardise the safety or security of
the vessel, life onboard or the environment in general.
(2) The master may refuse to receive onboard any person referred to in
sub-section (1) and if such person is onboard, may put him on shore, and the
person so refused admittance or put on shore shall not be entitled to return of any
fare he has paid.
(3) The master or other officer of any such vessel and all persons called by
him or other officer to his assistance, may detain any person who commits any
offence under sub-section (1) and convey the offender with all convenient
dispatch before the nearest police station to be dealt with in accordance with the
law.
126. (1) No vessel shall carry or attempt to carry cargo without the required
certificate in contravention of this Part or shall have onboard or in any part thereof
a cargo which is not in accordance with the certificate held by the vessel.
(2) No vessel shall carry or attempt to carry passengers without the required
certificate under this Part or shall have onboard or in any part thereof a number of
passengers which is greater than the number set forth in the certificate held by the
vessel.
(3) The master of any vessel which carries or attempts to carry cargo or
passengers in contravention of this section shall be liable to have his certificate of
competency cancelled or suspended for such a period as the Central Government
may, by order, specify in this behalf.
127. (1) Every person who sends or attempts to send a vessel to sea which
is unseaworthy, unless he proves that her going to sea in such unseaworthy state
was under the circumstances reasonable and justifiable, shall be liable to penalty
under this sub-section.
(2) Every master of a vessel who knowingly takes or attempts to take a
vessel to sea which is unseaworthy, unless he proves that her going to sea in such
unseaworthy state was under the circumstances, reasonable and justifiable, shall
be liable to penalty under this sub-section.
(3) For the purpose of giving proof under sub-sections (1) and (2), every
person charged under this section may give evidence in the same manner as any
other witness.
Vessel not to
proceed to sea
without valid
safety and
security
certificates.
Penalties for
certain acts.
Vessel not to
carry cargo or
passengers in
contravention of
Act.
Unseaworthy
vessel not to be
sent to sea.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 47
Obligation of
ship owner,
master or agent
with respect to
seaworthiness.
Safety and
security
management.
Power to make
rules.
128. (1) In every contract of service, express or implied, between the owner
of a vessel and the master or any seafarer thereof, there shall be implied,
irrespective of any agreement to the contrary, an obligation on the ship owner that
such ship owner and the master and every agent charged with the loading of such
vessel or the preparing thereof for sea or the sending thereof to sea, shall use all
reasonable means to ensure the seaworthiness of such vessel for the voyage at the
time when such voyage commences and to keep her in a seaworthy state during
the voyage.
(2) For the purpose of verifying compliance of the provisions of this section,
the Central Government may, either at the request of the ship owner or otherwise,
arrange for a survey of the hull, equipment or machinery of any sea-going vessel
by a surveyor or any person so authorised.
129. (1) Every vessel, company or port facility shall comply with such safety
and security management requirements as may be prescribed.
(2) The Central Government or a person authorised by it shall arrange for
the audit of the vessel, company or port facility for the purpose of sub-section (1).
(3) The Central Government or a person authorised by it may set different
levels of security and provide such information thereof, to all the port facilities
and all vessels entering into any port facility.
130. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the conditions subject to which the vessel shall comply with the
conventions, treaties or agreements to which India is a party and the safety
and security requirements to be complied by the vessels to which the said
conventions, treaties or agreements are not applicable, under sub-section (1)
of section 116;
(b) the safety and security requirements for different classes of vessels
and the certificates to be held by such vessels under sub-section (2) of
section 116;
(c) the manner of reporting the particulars of incidents and the
authority to whom such particulars shall be reported under sub-section (1)
and sub-section (2) of section 117;
(d) the manner of reporting the particulars of incidents and the
authority to whom such particulars shall be reported under sub-section (9)
of section 118;
(e) the communication equipment, distress and safety equipment and
the certified operators to be provided to every Indian vessel under
section 120;
(f) the information relating to the stability of passenger ship to be
approved under sub-section (2) of section 121;
(g) the safety and security management requirements to be complied
by the vessel, company or port facility under sub-section (1) of section 129;
(h) any other matter which is required to be or may be prescribed.
48 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
80 of 1976.
PART VII
PREVENTION AND CONTAINMENT OF POLLUTION FROM VESSEL AND
RESPONSE
131. Save as otherwise provided, this Part shall apply to,—
(a) Indian vessel and every other vessel registered in India;
(b) vessel other than an Indian vessel;
(c) vessel not entitled to fly the flag of India but which operate under
the authority of India;
(d) vessel that enters a port, shipyard or offshore terminal or place in
India or within the coastal waters;
(e) any incident of marine casualty or any act relating to such casualty
occurring with grave and imminent danger to Indian coastline or coastal
waters or related interests or posing a threat to the marine environment or to
the coastline or related interest, from pollution or threat of pollution in the
sea or air either by deliberate, negligent or accidental release of oil, ballast
water,
noxious liquid
substance, garbage, sewage, waste, harmful
anti-fouling substances, harmful emissions or any other harmful substance
including such incidents occurring on the high seas.
Explanation.—For the purposes of clauses (d) and (e), “coastal waters”
shall mean and include any part of the territorial waters of India, along with any
part of the adjoining maritime zones of India or any marine area adjacent
thereto over which India has, or, may hereafter have, exclusive jurisdiction in
regard to control of marine pollution under the Territorial Waters, Continental
Shelf, Exclusive Economic Zone and Other Maritime Zones Act, 1976, or any
other law for the time being in force;
(f) port for the purpose of providing reception facilities:
Provided that this Part shall not apply to any warship, naval auxiliary or
other vessel owned or operated by the Central Government or the State
Governments and used for the time being only on Government non-commercial
service unless otherwise specified by the Central Government by notification:
Provided further that the Director-General may provide equivalence to, or
grant exemption from, the provisions of this Part or the rules made thereunder, to
any vessel or person, in such manner as may be prescribed.
132. In this Part, unless the context otherwise requires,—
(a) “harmful substance” means any substance or form of energy,
which, if introduced into the sea or air, is liable to create hazards to human
health, harm living resources and marine life, damage amenities or interfere
with other legitimate uses of the sea or air and includes any substance
subject to control by any of the conventions to which India is a party or such
other substance as may be prescribed by the Central Government;
(b) “dumping” means any—
(i) deliberate disposal of waste water or other matter from
vessels, ports, platform or other man-made structures at sea; or
(ii) deliberate disposal of vessels, structures of ports, platform or
other man-made structures at sea,
but does not include—
(i) the disposal of wastes or other matter incidental to, or derived from
normal operations of vessels, platforms or other man-made structure at sea
and their equipment, other than wastes or other matter transported by or to
vessels, platforms or other man-made structures at sea, operating for the
Application
of
this Part.
Definitions.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 49
Control of
discharge or
emission of
harmful
substances or
dumping at sea.
Prevention and
containment of
pollution and
response.
purpose of disposal of such matter or derived from the treatment of such
wastes or other matter on such vessels, platform or structure; or
(ii) the placement of matter for a purpose other than the mere disposal
thereof:
Provided that such placement is not contrary to the aims of the London
Convention on the Prevention of Marine Pollution by Dumping of Wastes
and Other Matter, 1972;
(c) “port” shall include port facility, shipyard, ship breaking yards,
ship repair unit, offshore facilities and terminals;
(d) “vessel” means a vessel of any type, whatsoever, operating in the
marine or aquatic environment and includes hydrofoil boats, air-cushion
vehicles, submersibles, floating craft, floating platforms, floating storage
units and floating production storage and off-loading units but does not
include fixed platforms or other fixed man-made structures at sea for the
purposes of dumping.
133. (1) Save as otherwise provided, all vessels shall be under an obligation
to prevent discharge or emission of harmful substances or mixtures containing
harmful substances.
(2) All Indian vessels shall be fitted with such equipment and comply with
such requirements and conditions relating to construction, survey of equipment
and structure of vessel, as may be prescribed.
(3) No certificate shall be granted under this Part unless the requirements
and conditions of this section are complied with.
(4) The Central Government may designate such specific areas requiring
more stringent standards for pollution prevention as may be prescribed.
(5) The Central Government may, either at the request of the ship owner or
otherwise, arrange for the survey of the hull, equipment or machinery of any
vessel by a surveyor and, if found fit, shall grant certificates in accordance with
the provisions of this Act and rules made thereunder in such form, for such
duration and subject to such conditions as may be prescribed.
(6) The Central Government may take measures, as it may consider
appropriate, to prevent the pollution of the sea by the dumping of waste and other
matter that is liable to create hazards to human health, harm living resources and
marine life, damage amenities or interfere with other legitimate use of the sea.
(7) The Central Government may, by notification, specify the items
permitted for dumping in the coastal waters and may prescribe the manner in
which permissions for the dumping of such items may be obtained.
(8) Unless expressly permitted, no vessel, port, platform or other man-made
structures at sea shall engage in dumping in the coastal waters.
134. (1) Every vessel shall, subject to such conditions as may be prescribed,
comply with the provisions of the following international conventions, as
applicable, namely:—
(a) the MARPOL Convention;
(b) the Anti-Fouling Systems Convention;
(c) the Ballast Water Management Convention;
(d) International Convention Relating to Intervention on the High Seas
in Cases of Oil Pollution Casualties, 1969;
(e) any other pollution prevention convention or agreement or treaty
to which India is a party, as may be prescribed:
50 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
Provided that vessel to which the provisions of the above conventions are
not applicable shall comply with such pollution prevention requirements as may
be prescribed.
(2) A vessel shall possess such different types of certificates and documents
depending on the type, size, nature and area of operation of the vessel as may be
prescribed.
135. (1) No vessel shall proceed to sea unless such vessel is in possession
of valid certificates required under the convention or agreement or treaty referred
to in section 134.
(2) A vessel shall carry a valid certificate onboard and shall be subject to
inspection while at a port in India by the surveyor or an authorised person in such
manner as may be prescribed:
Provided that nothing in this sub-section shall be construed as limiting the
powers of any officer under any other law for the time being in force from
boarding and inspecting the vessel or its equipment.
(3) If the inspection under this section reveals that a vessel does not have a
valid certificate onboard or whose condition or equipment’s condition does not
meet the particulars of the certificate onboard, the vessel may be detained by order
by a proper officer until proceedings are concluded under this section or in the
opinion of the Central Government, the vessel can proceed to sea without
presenting an unreasonable threat or harm to safety of life at sea, marine
environment or the public health and welfare.
(4) Notwithstanding any proceedings initiated against the owner or master
of the vessel under this section, the Central Government may initiate further action
against such persons, if it determines that the incident of pollution continues to
cause harm or damage after the conclusion of the proceedings, or results in harm
or damages not discovered at the time of the initiation of the proceedings.
136. Every Indian vessel shall maintain such books of record in such form
and manner and the nature of entries to be made in the books of record, the custody
and disposal thereof, and all other matters relating thereto, shall be such as may
be prescribed.
137. (1) Where the Central Government has reasonable grounds to suspect
that a vessel which proposes to enter a port in India does not comply with the
requirements of this Part, it may direct the port to deny entry to such vessel.
(2) Where the Central Government has reasonable grounds to suspect that a
vessel does not comply with the requirements of this Part and poses a threat of
harm to the coast or coastal waters or has caused such harm, it may direct any
proper officer to detain the vessel or have the vessel moved to such place and for
such period as it may deem fit.
(3) Where any vessel detained under this section proceeds to sea before
being released, the master of the vessel, ship owner or any person who sends the
vessel to sea, shall be liable to penalty under this Act.
138. (1) Where an incident in which the cargo or harmful substances escape
or is likely to escape from a vessel causes or threaten to cause pollution of air,
marine environment or any part of coasts or coastal waters, the master of every
vessel shall report the particulars of such incident to such authority in such manner
as may be prescribed.
(2) The Central Government shall, upon receiving information regarding any
incident of pollution under sub-section (1), immediately take notice of such incident
and may direct the owner, agent, master, charterer, operator, lessee or licensee of
the vessel by notice served on him, to take the following actions, namely:—
Vessel not to
proceed to sea
without valid
pollution
prevention
certificates.
Record books.
Power to deny
entry, detain or
move vessel.
Power to take
measures for
containment of
pollution and
reporting of
incidents.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 51
(a) to prevent the escape of such harmful substances from the vessel,
as may be specified in such notice;
(b) to remove the cargo or oil or noxious liquid substance or harmful
substance from the vessel in such manner and to such place, as may be
specified in the notice;
(c) to remove the vessel to a place, as may be specified in the notice;
(d) to remove the cargo or oil or noxious liquid substance or harmful
substance slicks on the surface of the sea in such manner as may be specified
in the notice;
(e) to prohibit the removal of the vessel including any cargo or stores
therein, from a place specified in the notice; and
(f) any other action as may be considered necessary to prevent such
damage.
(3) If a vessel referred to in sub-section (1) is abandoned or a report from
such vessel is incomplete, the Central Government shall fix the responsibility of
the incident on the master or owner of that vessel.
(4) Where the release of harmful substances has caused or is likely to present
a grave and imminent danger to the coast or coastal waters, the Central
Government may proceed to take such measures as may be deemed necessary to
prevent, mitigate or eliminate such threat or danger.
(5) Where any person fails to comply with any notice served on him under
sub-section (2), the Central Government may, whether or not such person is
convicted of an offence under this Part by reason of his having so failed to comply,
cause such action to be taken as it may deem necessary for,—
(a) carrying out the directives given in the notice issued under
sub-section (2);
(b) containing the pollution caused or preventing the pollution
threatened to be caused, to any part of the coast or coastal waters by any
harmful substance having escaped or threatening to escape from the vessel.
(6) Subject to the provisions of this Part, any expenditure or liability
incurred by the Central Government in, or by reason of, the exercise of powers
under sub-section (5) in relation to any vessel in respect of which a notice had
been issued under this section, shall be a debt due to the Central Government and
may be recovered from the person or persons on whom the notice was served or
from all or any of those persons, and shall be a charge upon all or any vessel
owned by that person or persons which may be detained by the Central
Government until the amount is paid:
Provided that where the amount due to the Central Government is not paid
within reasonable time, the Central Government may cause all or any vessel
owned by such person or any part thereof to be sold, for the purpose of recovery
of such an amount with applicable interest.
(7) The Central Government shall have the power to take such measures as
may be deemed necessary to prevent, mitigate or eliminate grave and imminent
danger to the coastline or related interests from pollution or threat of pollution
following any incident on the high seas which may reasonably be expected to
result in major harmful consequences to the coastline or coastal waters.
(8) The Central Government may make national or regional arrangement
system for responding promptly and effectively to pollution incidents occurring
within the coastal waters.
52 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
139. (1) For the purposes of taking any measures under section 138, the
Central Government or any other officer authorised by it in this behalf, may, by
an order in writing, direct the owner of any Indian vessel or equipment to provide
such services or assistance as may be specified in that order.
(2) The owner of any vessel or equipment with respect to which an order is
made under sub-section (1), shall be entitled to tariff rates of freight and charter
hire, at reasonable rates having regard to current market conditions:
Provided that where tariff rates of freight are not fixed or where there is any
dispute about reasonable rate of charter hire, the freight or charter hire, shall be
paid at such rates as may be fixed by the Central Government by an order in
writing, subject to determination of reasonability of such rates of freight or charter
hire by examining such witnesses, documents and accounts as it may deem
necessary.
(3) The Director-General may,—
(a) requisition the services of any officer of the Central Government
or other officers or any police officer;
(b) requisition the resources and pollution prevention equipment
available with any of the offices of the Central Government or other offices
or organisations,
for the purposes of this Part and it shall be the duty of every such officer or office
or organisation to render assistance.
140. The Central Government shall prescribe such measures as it may deem
appropriate and practical, for the monitoring, detection and control of pollution
under this Part.
141. The Central Government may appoint such persons as analysts for the
purposes of incidents of pollution under this Part and specify the scope of powers
to be exercised by an analyst in this regard.
142. (1) Every port shall provide such reception facilities and surveillance,
supervision and guidance thereof as may be prescribed, taking into account the
pollution prevention conventions specified in section 134.
(2) The Central Government may give directions to the ports to take
appropriate measures to ensure that wastes or residue generated during operation,
repair and re-cycling of vessel are collected, handled, treated and disposed of in a
safe and environmentally sound manner to protect human health and the
environment.
(3) A port authority providing reception facilities or a person providing such
facilities by arrangement with the port authority may impose charges for the use
of the facilities at such rates and impose such conditions in respect of the use
thereof as may be notified by the Central Government in respect of the port.
(4) Where the Central Government is satisfied that there are no reception
facilities at any port or that the facilities available at such port or place are not
adequate for enabling vessels calling at such port or place to comply with the
requirements of the pollution prevention conventions, the Central Government
may direct, by order in writing, such authority to provide or arrange for the
provision of such reception facilities, as may be specified in the order.
(5) Any port that fails to comply with the directions under sub-section (4)
shall be liable to penalty under this Act.
143. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
Power of
Central
Government to
give directions.
Measures for
detection of
pollution.
Appointment of
analysts.
Reception
facilities.
Power to make
rules.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 53
Survey, audit
and
certification.
(a) the manner of providing equivalence or granting exemption to any
vessel or person under the second proviso to section 131;
(b) other substances which fall within the definition of “harmful
substances” in clause (a) of section 132;
(c) the equipment and requirements and conditions relating to
construction, survey of equipment and structure of vessel under
sub-section (2) of section 133;
(d) the pollution prevention standards and requirements for designated
areas under sub-section (4) of section 133;
(e) the form, duration and conditions subject to which a certificate
may be granted under sub-section (5) of section 133;
(f) the manner of obtaining permission for dumping in coastal waters
under sub-section (7) of section 133;
(g) the conditions subject to which the vessel shall comply with the
conventions, agreements or treaties specified in sub-section (1) of
section 134 including any other pollution prevention convention or
agreement or treaty to which India is a party and the pollution prevention
requirements to be complied with by the vessels on whom such
conventions, agreements or treaties do not apply;
(h) the types of certificates and documents under sub-section (2) of
section 134;
(i) the manner of inspection of certificates by a surveyor under
sub-section (2) of section 135;
(j) the form and manner of maintenance of record book and the nature
of entries to be made in the books of record, the custody and disposal
thereof, and other matters relating to maintenance of record book under
section 136;
(k) the particulars of the incident, the authority and the manner of
reporting incident under sub-section (1) of section 138;
(l) the measures to be taken by the Central Government for the
monitoring, detection and control of pollution under section 140;
(m) the reception facilities, surveillance, supervision and guidance
under sub-section (1) of section 142;
(n) any other matter which is required to be or may be prescribed.
PART VIII
SURVEY, AUDIT AND CERTIFICATION
144. (1) Every Indian vessel, company or port shall unless otherwise
exempted by the Central Government, be surveyed or audited or certified for
verification of compliance with the conventions specified in section 147 and such
requirements for different classes of vessels, company or port, as may be
prescribed.
Explanation.—In this Part, unless the context otherwise requires, “company”
shall have the same meaning as assigned to it in clause (a) of section 115.
(2) A surveyor or any person authorised by the Director-General in this
behalf may, if satisfied that any vessel, company or port has been surveyed or
audited as per the requirements under this Act, grant certificate or documents to
such vessel, company or port.
54 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(3) Notwithstanding anything contained in this Act, where any survey or
audit of a vessel, company or port under this Part is completed, the owner, agent
or master of such vessel, company or port shall not make or cause to be made any
alteration in the structure, equipment, fittings, arrangements, material, systems or
scantlings covered by the survey or audit without the prior permission of the
Central Government.
(4) If, after grant of certificates or documents under sub-section (2), the
Central Government or any person authorised by it, has reason to believe that
changes have been made to the structure, equipment, fittings, arrangements,
material, systems or scantlings, or they have sustained any damage or are
otherwise found insufficient, then the Central Government or any person
authorised by it in this behalf may require that the vessel, company or port be
re-surveyed or audited to such extent, as it may deem fit, or it may modify or
revoke or suspend or cancel or surrender the certificates and documents, after
giving an opportunity of being heard, in such manner as may be prescribed.
(5) No vessel shall proceed to sea unless the owner or master of the vessel
holds onboard all the certificates or documents as required under this section.
145. Every vessel, company or port shall, unless exempted under this Part,
be in possession of such certificates as may be prescribed.
146. (1) Save as otherwise provided, a surveyor may at any reasonable time,
go onboard a vessel and may inspect or audit the vessel or any part thereof, the
structure, equipment, fittings, arrangements, materials, systems, scantlings, cargo,
provisions, stores, her certificates and certificates of the seafarers onboard:
Provided that he shall not unreasonably hinder the operation of the vessel
or detain or delay her from proceeding on any voyage.
(2) The owner, agent, master or every officer of the vessel shall afford to the
surveyor all reasonable facilities for survey and provide all such information in
respect of the vessel and her structure, equipment, fittings, arrangements,
materials, scantlings, systems, cargo, provisions, stores, her certificates and
certificates of the seafarers, as the surveyor may require.
147. Every vessel, company or port shall be surveyed, audited and certified
to confirm compliance with the following conventions as applicable, namely:—
(a) the Safety Convention;
(b) the MARPOL Convention;
(c) the Anti-Fouling Systems Convention;
(d) the Ballast Water Management Convention;
(e) the Load Lines Conventions;
(f) the Tonnage Measurement Convention, 1969;
(g) the Special Trade Passenger Ships Agreement, 1971 and its
Protocol;
(h) the Convention on the International Regulations for Preventing
Collisions at Sea, 1972;
(i) the International Convention on Maritime Search and Rescue, 1979
(SAR 1979);
(j) the Maritime Labour Convention, 2006; or
(k) any other convention relating to survey, audit or certification as
may be prescribed.
Certificates.
Power of
surveyor.
Compliance of
provisions of
convention.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 55
Recognition of
certificates
granted outside
India.
Grant of
certificate to
foreign vessels
in India and
Indian vessels in
foreign States.
Power to call for
information.
Power to
conduct
inspections.
148. A valid certificate granted under a convention in respect of a vessel
other than an Indian vessel by the Government of the State to which the vessel
belongs, shall subject to such rules as the Central Government may make in this
behalf, have the same effect in India as the corresponding certificates granted in
respect of an Indian vessel.
149. (1) The Central Government may, at the request of the Government of
a State to which a convention applies, cause an appropriate convention certificate
to be granted in respect of a vessel registered or to be registered in that State, if it
is satisfied in like manner as in the case of an Indian vessel that such certificate
may be granted and where a certificate is granted at such a request, it shall contain
a statement to that effect.
(2) The Central Government may request the Government of a State to
which a convention applies to grant an appropriate convention certificate in
respect of a vessel registered or to be registered in India and a certificate granted
in pursuance of such a request shall have effect for the purposes of this Act, as if
it had been granted by the Central Government.
Explanation.—For the purposes of this section, “convention certificate”
means a certificate granted under the provisions of any convention.
150. (1) The Central Government, surveyor, or any other person authorised
in this behalf, shall have the power to require the master of a vessel to which this
Part applies, to give such information as may be required to ensure compliance
with the provisions of this Part.
(2) The surveyor or any other person empowered under sub-section (1), shall
have the powers of a civil court while trying a suit under the Code of Civil
Procedure, 1908, in respect of the following matters, namely:—
(a) summoning and enforcing the attendance of any person and
examining him on oath;
(b) requiring discovery and production of any document;
(c) receiving evidence on affidavit;
(d) any other matter which is required to be or may be prescribed.
(3) Any person who refuses or fails to give the information referred to in
sub-section (1), shall be liable for a penalty under this Act.
151. (1) The Central Government may, by notification, appoint such persons
to conduct inspections of any vessel to which this Part applies, in order to—
(a) verify whether the vessel has violated any provisions of this Act or
rules made thereunder;
(b) comply with the request of a contracting party to any convention,
agreement or treaty referred to in section 147, for an investigation as to
violation of any provisions of such convention, agreement or treaty, by an
Indian vessel;
(c) comply with such other matter as may be prescribed.
(2) The violation noticed in the inspection conducted under sub-section (1)
shall be reported to the Central Government in such form and manner as may be
prescribed.
(3) The Central Government may, upon receipt of the report under
sub-section (2), take any action or direct the master of the vessel to take such
action as may be required.
5 of 1908.
56 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
152. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the requirements for different classes of vessels, company or ports
for survey, audit and certification under sub-section (1) of section 144;
(b) the manner of re-survey, audit and certification of vessel, company
or port and modification, revocation, suspension, cancellation or surrender
of the certificates and documents under sub-section (4) of section 144;
(c) the certificates to be possessed by a vessel, company or port under
section 145;
(d) any other convention relating to survey, audit or certification under
clause (k) of section 147;
(e) any other power of the surveyor or other person under clause (d)
of sub-section (2) of section 150;
(f) any other matter for compliance of which inspections may be
conducted under clause (c) of sub-section (1) of section 151;
(g) the form and manner of report to be made to the Central
Government under sub-section (2) of section 151;
(h) any other matter which is required to be or may be prescribed.
PART IX
MARITIME LIABILITY AND COMPENSATION
CHAPTER I
COLLISION, ACCIDENT AT SEA AND LIABILITY
153. (1) This Chapter shall apply to,—
(a) Indian vessels; and
(b) any vessel other than an Indian vessel while it is at a port or place
in India including the coastal waters.
(2) All claims arising out of pollution damage under Chapter III or
Chapter IV of this Part shall be adjudicated in accordance with the provisions
of those Chapters.
154. (1) Each vessel shall bear its own damage if the collision is accidental
or the cause of the collision is not determined.
(2) If the collision is caused by the fault of one of the vessels, the liability to
make good the damages or loss caused to one or more of those vessels or to their
cargo or to any property of the seafarers, passengers or other persons onboard or
the liability for loss of life or personal injury, shall be of the vessel which has
committed the fault.
(3) If the collision is caused by the fault of two or more vessels, the liability
of each vessel, to make good the damages or loss caused to one or more of those
vessels or to their cargo or to any property of the seafarers, passengers or other
persons onboard or the liability for loss of life or personal injury, shall be in
proportion to the degree of faults respectively committed by each such vessel:
Power to make
rules.
Application of
this Chapter.
Apportionment
of liability.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 57
Damage or loss
of vessel, cargo
or property.
Joint and several
liability for loss
of life or
personal injury.
Right of
contribution.
Provided that if, having regard to all the circumstances of the case, it is not
possible to establish different degrees of fault, the liability shall be apportioned
equally.
(4) For the purposes of this Chapter, for any maritime claim arising out of
collision between vessels, the High Court may, in the course of proceedings under
this Act, assign all or any of the following duties to any assessors, appointed by
the Central Government under the Admiralty (Jurisdiction and Settlement of
Maritime Claims) Act, 2017, namely:—
(a) determination of fault, including the degree of fault attributable to
each vessel;
(b) attend the proceedings and present their written findings before the
High Court; and
(c) any other duties as may be assigned by the High Court.
155. (1) Whenever, by fault of two or more vessels, damage or loss is caused
to one or more of them or to the cargo of one or more of them or to any property
of the seafarers, passengers or other persons onboard one or more of them, the
liability, including liability to third parties, to make good the damage or loss shall
be in proportion to the degree in which each vessel was at fault.
(2) Nothing in this section shall be construed to render any vessel liable for
any loss or damage to which her fault has not contributed.
(3) Nothing in this section shall affect the liability of any person under any
contract, or shall be construed as imposing any liability upon any person from
which he is exempted by any contract or by any provision of law, or as affecting
the right of any person to limit his liability in the manner provided by law.
(4) For the purposes of this Chapter, references to damage or loss caused by
the fault of a vessel shall be construed as including references to any salvage or
other expenses consequent upon that fault, recoverable under any law for the time
being in force by way of damages.
156. (1) Whenever loss of life or personal injuries are suffered by any person
onboard a vessel owing to the fault of that vessel and any other vessel, the liability
to third parties, of the owners of the vessels concerned shall be joint and several.
(2) Nothing in this section shall be construed as depriving any person of any
right of defence on which he might have relied in an action brought against him
by the person injured, or any person entitled to sue in respect of such loss of life,
or shall affect the right of any person to limit his liability in cases to which this
section relates.
157. (1) Whenever loss of life or personal injuries are suffered by a person
onboard a vessel owing to the fault of that vessel and of any other vessel and a
proportion of the damages is recovered from the owner of one of the vessels which
exceeds the proportion in which she was in fault, the said owner may recover by
way of contribution the amount of the excess from the owners of the other vessels
to the extent to which those vessels were respectively in fault:
Provided that no amount shall be so recovered which shall not, by reason of
any statutory or contractual limitation of, or exemption from, liability or which
shall not for any other reason, have been recovered in the first instance as damages
by the persons entitled to sue therefor.
22 of 2017.
58 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(2) In addition to any other remedy provided by law for the time being in
force, the person entitled to any contribution under sub-section (1) shall, for the
purpose of recovering the contribution, have subject to the provisions of this Act,
the same rights and powers as the persons entitled to sue for damages in the first
instance.
158. (1) In every case of collision between two vessels, it shall be the duty
of the master or person in-charge of each vessel in and so far as he can do so
without danger to his own vessel, seafarers and passengers, if any,—
(a) to render to the other vessel, her master, seafarers and passengers,
if any, such assistance as may be practicable and necessary to save them
from any danger caused by the collision and to stay by the other vessel until
he has ascertained that she has no need of further assistance; and
(b) to give to the masters or persons in-charge of the other vessels, the
name of his own vessel and of the port to which she belongs and also from
which she comes and to which she is bound.
(2) The failure of the master of a vessel to comply with the provisions of
this section shall not raise any presumption of liability under this Chapter.
159. In every case of collision in which it is practicable so to do, the master
of every vessel shall immediately after the occurrence, cause a statement thereof
and of the circumstances under which the same occurred, to be entered in the
official logbook, if any, and the entry shall be signed by the master and also by
the officer on watch or one of the seafarers.
160. When an Indian vessel or other vessels to which this Chapter applies,
has sustained or caused any accident occasioning loss of life or any serious injury
to any person or has received any material damage affecting her seaworthiness or
her efficiency either in her hull or is so altered in any part of her machinery as not
to correspond with the particulars contained in any of the certificates granted
under this Act in respect of the vessel, the master or ship owner or his agent shall,
within such time as may be prescribed, after the happening of the accident or
damage or as soon thereafter as possible, transmit to the Director-General or the
nearest principal officer a report of the accident or damage and of the probable
cause thereof stating the name of the vessel, her official number, if any, her port
of registry and the place where she is.
161. If the owner or agent of any Indian vessel has reason, owing to the
non-appearance of the vessel or to any other circumstance, to apprehend that the
vessel is wholly lost, he shall as soon as may be, send notice in writing to the
Director-General relating to the loss and the cause of such loss stating the name
of the vessel, her official number, if any, and her port of registry.
CHAPTER II
LIMITATION OF LIABILITY FOR MARITIME CLAIMS
162. (1) The ship owner or salvor or any person for whose act, neglect or
default, the ship owner or salvor, or any such person is responsible, and the insurer
of liability for such claims, may limit his liability for claims in respect of—
(a) loss of life or personal injury or loss of or damage to property
including damage to harbour works, basins and waterways and aids to
navigation, occurring onboard or in direct connection with the operation of
the vessels or with salvage operations and consequential loss resulting
therefrom;
Duty of master
of vessel to
assist in case of
collision.
Collision to be
entered in
official logbook.
Report to Director-
General of
accidents to
vessels.
Notice of loss of
Indian vessel to be
given to Director-
General.
Limitation of
liability for
damages in
respect of
certain claims.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 59
(b) loss resulting from delay in the carriage by sea of cargo, passengers
or their luggage;
(c) other loss resulting from infringement of rights other than contractual
rights, occurring in direct connection with the operation of the vessel or salvage
operations;
(d) the raising, removal, destruction or the rendering harmless of a
vessel which is sunk, wrecked, stranded or abandoned, including anything
that is or has been onboard such vessel;
(e) the removal, destruction or the rendering harmless of the cargo of
the vessel;
(f) a person other than the person liable in respect of measures taken
in order to avert or minimise loss for which the person liable may limit his
liability in accordance with the Limitation of Liability for Maritime Claims
Convention and further loss caused by such measures.
(2) The claims set out under sub-section (1) shall be subject to limitation of
liability, even if brought by way of recourse or for indemnity under a contract or
otherwise:
Provided that claims set out under clauses (d), (e) and (f) of sub-section (1)
shall not be subject to limitation of liability to the extent they relate to
remuneration under a contract with the person liable.
(3) Nothing in this section shall apply to,—
(a) claims for salvage, including any claim for special compensation
under
Article 14 of the Salvage Convention, or contribution in
general average;
(b) claims for oil pollution damage under Chapter III of this Part
relating to civil liability for oil pollution damage;
(c) claims subject to any convention or any law for the time being in
force in India governing or prohibiting limitation of liability for nuclear
damage;
(d) claims against the ship owner of a nuclear vessel for nuclear
damage;
(e) claims by servant of the ship owner or salvor whose duties are
connected with the vessel or the salvage operations, including claims of their
heirs, dependants or other persons entitled to make such claims, if under the
law governing the contract of service between the ship owner or salvor and
such servants, the ship owner or salvor is not entitled to limit his liability in
respect of such claims, or if he is by such law only permitted to limit his
liability to an amount greater than that provided in the Limitation of
Liability for Maritime Claims Convention or the rules made under
sections 165 and 166.
Explanation 1.—For the purposes of this section, the act of invoking limitation
of liability shall not be an admission of liability.
Explanation 2.—For the purposes of this Chapter,—
(a) the liability of a ship owner shall include the liability in an action
brought against the vessel herself;
60 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(b) “ship owner” means the owner, charterer, manager or operator of
a sea-going vessel.
163. A person shall not be entitled to limit his liability under section 162, if
it is proved that the loss resulted from his personal act or omission, committed
with the intent to cause such loss, or committed recklessly and with knowledge
that such loss is likely to result.
164. Where a person entitled to limitation of liability under this Chapter has
a claim against the claimant arising out of the same occurrence, their respective
claims shall be set off against each other and the provisions of this Chapter shall
apply only to the balance, if any.
165. (1) The limits of liability for claims other than passenger claims under
section 166 arising on any distinct occasion, shall be calculated in accordance
with the provisions of the Limitation of Liability for Maritime Claims
Convention:
Provided that in cases where the provisions of the Limitation of Liability for
Maritime Claims Convention are not applicable, the limit of liability shall be such
as may be prescribed.
(2) Where the amount calculated in respect of claims for loss of life or
personal injury is insufficient to pay such claims in full, the amount calculated in
respect of other claims shall be available for payment of the unpaid balance of
claims in respect of claims for loss of life or personal injury and such unpaid
balance shall rank rateably with claims in respect of other claims.
(3) Without prejudice to the right of claims for loss of life or personal injury
under sub-section (2), the claims in respect of damage to harbour works, basins,
waterways and aids to navigation shall have priority over other claims.
(4) The limits of liability for any salvor not operating from any vessel or for
any salvor operating solely on the vessel to, or in respect of which he is rendering
salvage services, shall be calculated according to gross tonnage as provided in the
Convention on Limitation of Liability for Maritime Claims.
166. In respect of claims arising on any distinct occasion for loss of life or
personal injury to passengers of a vessel, the limit of liability of the owner thereof
shall be such as may be prescribed.
Explanation.—For the purposes of this section, “claims arising on any
distinct occasion for loss of life or personal injury to passengers of a vessel” shall
mean any claim brought by or on behalf of any person carried in that vessel,—
(a) under a contract of passenger carriage; or
(b) who, with the consent of the carrier, is accompanying a vehicle or
live animals which are covered by a contract for the carriage of goods.
167. (1) The limits of liability determined under section 165 shall apply to
the aggregate of all claims which arise on any distinct occasion,—
(a) against the person or any person for whose act, neglect or default,
he is responsible; or
(b) against a ship owner rendering salvage services from that vessel
and a salvor operating from such vessel and any person for whose act,
neglect or default he is responsible; or
(c) against the salvor who is not operating from a vessel or who is
operating solely on the vessel in respect of which the salvage services are
rendered and any person for whose act, neglect or default, such salvor is
responsible.
Conduct
barring
limitation.
Counter claims.
Limits of
liability.
Limit for
passenger
claims.
Aggregation of
claims.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 61
Constitution of
limitation fund.
Limitation of
liability without
constitution of a
limitation fund.
Distribution of
fund.
(2) The limits of liability determined under section 165 shall apply to the
aggregate of all claims subject thereto which may arise on any distinct occasion
against the ship owner in respect of the vessel referred to in that section and any
person for whose act, neglect or default he is responsible.
168. (1) Any person alleged to be liable may constitute a fund with the
Central Government or the High Court in which legal proceedings are instituted
or expected to be instituted in respect of claims which can be limited under this
Chapter.
(2) The fund shall be constituted in the sum of the amounts calculated in
accordance with the provisions of section 165 or section 166, read with
section 167, as are applicable to claims for which limitation of liability is invoked
and which arise from the same distinct occasion, together with interest at such rate
as may be notified by the Central Government thereon from the date of occurrence
giving rise to the liability until the date of the constitution of the fund.
(3) The limitation fund of the value calculated in accordance with
sub-section (2) or stipulated by the High Court or the Central Government, shall
be constituted by—
(a) depositing the amount; or
(b) producing a guarantee acceptable under any law for the time being
in force and considered to be adequate by the High Court or the Central
Government.
(4) The fund so constituted shall be available only for the payment of claims
in respect of which limitation of liability may be invoked.
(5) The fund constituted by one of the persons or ship owner or salvors
referred to in section 167, or his insurer, shall be deemed to be constituted by all
such persons or ship owners or salvors or their insurers.
169. (1) Limitation of liability may be invoked notwithstanding that a
limitation fund has not been constituted under section 168.
(2) In case the right to limitation of liability is invoked without the
constitution of a limitation fund under section 168,—
(a) the High Court shall adjudicate each claim for its full proven
amount and declare the right of the person liable to limit his liability and for
the purpose of enforcement, the amount of limitation shall be applicable to
the respective claims; and
(b) the claimant shall not be barred from taking other action in respect
of such claims.
(3) Section 171 shall not be applicable unless a limitation fund is constituted
under section 168.
170. (1) Subject to the limits of liability under sections 165 and 166, the
fund shall be distributed among the claimants in proportion to their established
claims.
(2) No lien or other right in respect of any vessel or property shall affect the
proportions in which the fund is distributed among several claimants under this
section.
(3) If before the fund is distributed, the person liable or his insurer has
settled a claim against the fund, such person shall, up to the amount he has paid,
acquire by subrogation the rights which the person so compensated would have
enjoyed under this Chapter.
62 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(4) The right of subrogation under sub-section (3) may also be exercised by
any person other than the person liable or his insurers in respect of any amount of
compensation which such person may have paid.
(5) Where the person liable or any other person establishes that he may be
compelled to pay at a later date, in whole or in part any such amount of
compensation with regard to which such person would have enjoyed a right of
subrogation under this section had the compensation been paid before the fund
was distributed, the High Court or the Central Government where the fund is
constituted may order that a sufficient sum be provisionally set aside to enable
such person to enforce his claim against the fund at such later date.
171. (1) Where a fund is constituted under section 168, any person having
made a claim against the fund shall be barred from exercising any right in respect
of such claim against any other vessel or property of a person by or on behalf of
whom the fund was constituted.
(2) After a fund is constituted under section 168, if any vessel or other
property, belonging to a person on behalf of whom the fund was constituted, is
arrested or attached for a claim which may be raised against the fund, or any
security given, may be released by an order of the High Court and such release
shall always be ordered by the High Court whether or not the fund was constituted
with the same or any other High Court or with the Central Government.
(3) The provisions of sub-sections (1) and (2) shall apply only if the claimant
makes a claim against the fund before the High Court or the Central Government
administering that fund and the fund is actually available and freely transferable
in respect of that claim.
172. (1) Every registered owner of an Indian vessel and of any vessel other
than an Indian vessel entering or departing a port in India or operating in the
coastal waters shall maintain compulsory insurance or such other financial
security from an insurer or organisation as may be prescribed, in respect of such
vessel.
(2) The insurance shall cover maritime claims subject to limitation specified
under section 162.
(3) The amount of insurance for each and every vessel per incident shall be
at least equal to the relevant maximum amount for the limitation of liability
provided under section 165 and for passenger claims the relevant maximum
amount for the limitation of liability under section 166.
(4) Any vessel departing a port in India in contravention of this section shall
be liable to be detained by such authority as may be prescribed.
173. (1) The provisions of this Chapter shall apply to any person referred to
in section 162 who seeks to limit his liability before the High Court or seeks to
procure the release of a vessel or other property or the discharge of any security
given within India but shall not apply to any person who does not have—
(a) habitual residence in India; or
(b) principal place of business in India; or
(c) any vessel in relation to which the right of limitation is invoked or
whose release is sought and which does not fly the flag of a State which is
a party to the Convention on Limitation of Liability for Maritime Claims,
at the time of invocation of the provisions of this Chapter.
Bar to other
actions.
Compulsory
insurance or
other financial
security for
maritime claims
subject to
limitation.
Scope of
application of
this Chapter.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 63
Power to make
rules for matters
under Chapters I
and II of this
Part.
Application of
this Chapter.
Definitions.
(2) The provisions of this Chapter shall not apply to air-cushion vehicles or
floating platforms constructed for the purpose of exploring or exploiting the
natural resources of the sea-bed or the sub-soil thereof.
174. (1) The Central Government may make rules to carry out the provisions
of Chapter I and this Chapter.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the time within which the master or ship owner or his agent shall
report the accident to the Director-General or the nearest principal officer
under section 160;
(b) the limits of liability in cases where the provisions of the
Limitation of Liability for Maritime Claims Convention are not applicable
under the proviso to sub-section (1) of section 165;
(c) the limit of liability of the ship owner for loss of life or personal
injury to passengers of a vessel under section 166;
(d) insurer or other organisation and other financial security whose
insurance is acceptable under sub-section (1) of section 172;
(e) the authority competent to detain any vessel under sub-section (4)
of section 172;
(f) any other matter which is required to be or may be prescribed.
CHAPTER III
CIVIL LIABILITY FOR OIL POLLUTION DAMAGE
175. This Chapter shall apply to,—
(a) pollution damage caused by,—
(i) Indian vessel within the jurisdiction of any contracting party
to the Civil Liability Convention; and
(ii) Indian vessel and any ship while it is at a port or place in
India including the coastal waters, extending not more than two
hundred nautical miles from the baseline;
(b) preventive measures, wherever taken, to prevent or minimise such
pollution damage.
176. In this Chapter, unless the context otherwise requires,—
(a) “incident” means any occurrence, or series of occurrences having
the same origin, which causes pollution damage or creates a grave and
imminent threat of causing such damage;
(b) “oil” means any persistent hydrocarbon mineral oil such as crude
oil, fuel oil, heavy diesel oil and lubricating oil whether carried onboard a
ship as cargo or in the bunkers of such ship;
(c) “person” means any individual or partnership or any public or
private body, whether corporate or not, including a State or any of its
constituent sub-divisions;
(d) “pollution damage” means,—
(i) loss or damage caused outside the ship by contamination
resulting from the escape or discharge of oil from the ship, wherever
such escape or discharge occurs:
64 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
Provided that compensation for impairment of the environment
other than loss of profit from such impairment shall be limited to costs
of reasonable measures of reinstatement actually undertaken or to be
undertaken; and
(ii) the costs of preventive measures and further loss or damage
caused by preventive measures;
(e) “preventive measures” means any reasonable measures taken by
any person after an incident has occurred to prevent or minimise pollution
damage;
(f) “ship” means any sea-going vessel and seaborne craft of any type
whatsoever constructed or adapted for the carriage of oil in bulk as cargo:
Provided that a ship capable of carrying oil and other cargoes shall be
regarded as a ship only when it is actually carrying oil in bulk as cargo and
during any voyage following such carriage unless it is proved that it has no
residues of such carriage of oil in bulk aboard;
(g) “ship owner” means,—
(i) the person registered as the owner of the ship; or
(ii) in the absence of registration, the person owning the ship; or
(iii) in the case of a ship owned by any State, the persons
registered in that State as the operator of such ship.
177. (1) Save as otherwise provided in sub-sections (2) and (3), the ship
owner shall be liable for any pollution damage caused by the ship as a result of
the incident and where the incident consists of a series of occurrences, from the
time of the first of such occurrences.
(2) No liability for pollution damage shall be attached to the ship owner, if
he proves that the pollution damage,—
(a) resulted from an act of war, hostilities, civil war, insurrection or a
natural phenomenon of an exceptional, inevitable and irresistible character; or
(b) was wholly caused by an act or omission done with intent to cause
damage by a third party; or
(c) was wholly caused by the negligence or other wrongful act of any
Government or other authority responsible for the maintenance of lights or
other navigational aids in the exercise of that function.
(3) Where the ship owner proves that the pollution damage resulted either
wholly or partially from an act or omission done with intent to cause damage by
the person who suffered the damage or from the negligence of that person, the
ship owner may be exonerated wholly or partially from his liability to such person.
(4) No claim for compensation for pollution damage may be made against
the ship owner otherwise than in accordance with the provisions of this Chapter.
(5) Subject to sub-section (6), no claim for compensation for pollution
damage under this Chapter or otherwise may be made against,—
(a) the servants or agents of the ship owner or the seafarers;
(b) the pilot or any other person who, not being a seafarer, performs
services for the ship;
(c) any charterer (howsoever described including a bareboat
charterer), manager or operator of the ship;
Liability of ship
owner.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 65
Joint and several
liability for
ships.
Jurisdiction of
High Court.
Jurisdiction
where pollution
damage occurs
in two or more
States.
Limitation of
liability.
Constitution of
limitation fund.
(d) any person performing salvage operations with the consent of the
ship owner or on the instructions of a competent public authority;
(e) any person taking preventive measures;
(f) any servant or agent of persons mentioned in clauses (c), (d)
and (e),
unless the damage resulted from their personal act or omission, committed with
the intent to cause such damage, or committed recklessly and with knowledge that
such damage is likely to result.
(6) Nothing in this Chapter shall prejudice any right of recourse of the ship
owner against third parties.
178. When an incident involving two or more ships occur and pollution
damage results therefrom, all the ship owners concerned, unless exonerated under
sub-section (3) of section 177, shall be jointly and severally liable for all such
damage which is not reasonably separable.
179. (1) The admiralty jurisdiction of the respective High Courts under the
Admiralty (Jurisdiction and Settlement of Maritime Claims) Act, 2017, shall be
deemed to extend to any claim for liability arising under this Chapter and shall
also extend to any case arising out of such claim, including the constitution of a
limitation fund (hereafter in this Chapter referred to as fund) by the ship owner.
(2) All claims arising out of an incident of oil pollution, including the
constitution of a fund, shall be made in the High Court having jurisdiction over
the pollution damage and if the pollution damage occurs in the Exclusive
Economic Zone, or more than one High Court has jurisdiction over such pollution
damage, the claim may be made in the High Court which has jurisdiction over the
port or place where the ship responsible for such pollution damage is detained.
180. Where pollution damage occurs in the territory of one or more other
contracting parties to the Civil Liability Convention, or preventive measures have
been taken to prevent or minimise pollution damage in the territory of such
contracting parties, claims for compensation may be brought in the courts of any
such contracting party:
Provided that once a fund is established in India in accordance with the
provisions of this Chapter, only the High Court or the Central Government shall
have jurisdiction to determine matters relating to apportionment and distribution
of the fund.
181. (1) The ship owner may limit his liability under this Chapter in respect
of any incident, to an aggregate amount in accordance with Article V of the Civil
Liability Convention.
(2) The ship owner shall not be entitled to limit his liability under this
Chapter if it is proved that the pollution damage resulted from his personal act or
omission, committed or made with the intent to cause such damage, or recklessly
and with knowledge that such damage is likely to result.
182. (1) Any ship owner, desiring to avail of the benefit of limitation of his
liability under this Chapter, shall apply to the High Court having jurisdiction or
the Central Government for constitution of a fund for the total sum representing
his limits of liability, within such time and in such manner, as may be prescribed.
(2) Such fund may be constituted either by depositing the sum or by
furnishing bank guarantee or such other security with the High Court or the
Central Government.
22 of 2017.
66 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(3) The insurer or any other person providing financial security to the ship
owner may apply to the High Court or the Central Government for constitution of
the fund under sub-section (1) and the fund so constituted shall have the same
effect as if it were constituted by the ship owner.
(4) An application for constitution of the fund may be made by the insurer
under this section even in cases where the ship owner is not entitled to limit his
liability under sub-section (2) of section 181 and in any such event, constitution
of the fund shall not prejudice the rights of any claimant against the ship owner
for full compensation exceeding the amount deposited or secured in the fund.
(5) The amount in Special Drawing Rights to be deposited or secured in the
fund under this section shall be converted in rupees on the basis of official value
in rupees of the Special Drawing Rights as determined by the Reserve Bank of
India on the date of constitution of the fund.
(6) Where a fund is established by the ship owner in relation to an incident
of oil pollution before a High Court, all claims for compensation under this
Chapter shall only be instituted in the High Court where the fund was constituted:
Provided that where claims arising out of the incident of oil pollution is
made in High Courts other than the one where the fund was established, the ship
owner may approach the Supreme Court in accordance with the Code of Civil
Procedure, 1908 to transfer the claims to the High Court where such fund was
established.
183. (1) Upon constitution of the fund, the High Court or the Central
Government shall issue a notice inviting claims against the fund arising from the
particular incident of oil pollution, within such time and containing such other
particulars as may be prescribed.
(2) Any person who has suffered pollution damage shall be entitled to claim
compensation and may make an application for participation in the proceedings:
Provided that where such fund has not been established, the claimant may
approach the High Court having jurisdiction or the Central Government under
section 180.
(3) The Central Government shall issue a notice of proceedings to the
International Oil Pollution Compensation Fund which is entitled to participate in
the proceedings in accordance with Chapter V of this Part.
(4) The Central Government may prescribe the procedure to be followed for
establishment of the fund and adjudication of claims arising from an incident of
oil pollution.
184. (1) Where, before the fund is distributed, the ship owner or any of his
servants or agents or any person providing him insurance or other financial
security has as a result of an incident paid compensation for pollution damage,
such person shall upto the amount he has paid, acquire by subrogation the rights
which the person so compensated may have enjoyed under this Chapter.
(2) Where the ship owner or any other person establishes that he may be
compelled to pay at a later date in whole or in part any such amount of
compensation with regard to which such person shall have enjoyed a right of
subrogation under sub-section (1) had the compensation been paid before the fund
was distributed, the High Court where the fund was constituted may order that a
sufficient sum be provisionally set aside to enable such person to enforce his claim
against the fund at such later date.
185. (1) The High Court or the Central Government shall consolidate all
claims against the fund including those arising out of subrogation under
section 184.
Claims for
compensation
where fund is
established.
Acquisition of
right for
compensation
by subrogation.
Consolidation of
claims and
distribution of
fund.
5 of 1908.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 67
Arrest and sale
of ship if ship
owner, etc.,
unable to satisfy
claims for
compensation.
Restriction on
enforcement of
claims after
establishment of
fund.
Compulsory
insurance or
other financial
security.
(2) Any claim in respect of expenses reasonably incurred or sacrifices
reasonably made by the ship owner voluntarily to prevent or minimise pollution
damage shall rank equally with other claims against the fund.
(3) Subject to the right of subrogation under section 184, the High Court or
the Central Government shall distribute the amount in the fund among all
claimants in proportion to their established claims.
(4) If the ship owner, insurer or other financial security holder has failed to
establish a fund under this Chapter, the High Court shall make an order for
compensation against such party to be payable within such period as may be
specified in the order.
186. (1) Where the High Court makes an order for compensation which the
ship owner has not complied with and such owner has not established a fund, an
application may be made by a person entitled to compensation to that court to
arrest the ship responsible for the incident or any ship owned by such person.
(2) The High Court may direct the amount remaining unpaid after
determination of liability of the International Oil Pollution Compensation Fund,
in accordance with Chapter V of this Part, to be levied by distress and sale of the
ship and her equipment in accordance with this Act.
(3) The High Court or the Central Government shall have the power to
detain any ship involved in an incident of oil pollution, until the ship owner has
established a fund in accordance with section 182, or has duly complied with the
order for compensation under sub-section (4) of section 185, whichever is earlier.
187. Where the ship owner after an incident has constituted a fund in
accordance with this Chapter and is entitled to limit his liability,—
(a) no person having a claim for pollution damage arising out of that
incident shall be entitled to exercise any right against any other ship and
property of the ship owner in respect of such claim;
(b) the High Court or the Central Government shall order the release
of any ship or other property belonging to the ship owner which has been
detained in respect of a claim for pollution damage arising out of that
incident and shall similarly release any bail or other security furnished to
avoid any arrest:
Provided that this section shall apply only if the sum paid into the High
Court or to the Central Government, or such part thereof as corresponds to the
claim, is actually available to the claimant.
188 (1) The owner of every ship carrying more than two thousand tons of
oil in bulk as cargo shall in respect of such ship maintain an insurance or other
financial security to cover his liability for pollution damage under this Chapter for
the amount specified under the provisions of the Civil Liability Convention:
Provided that the Central Government may require the owner of a ship
carrying such tons of oil in bulk, to maintain insurance or other financial security
to cover his liability for pollution damage upto such limits, as may be prescribed.
(2) In respect of every Indian vessel which maintains insurance or other
financial security under sub-section (1), there shall be granted by the Central
Government a certificate in such form and giving such particulars, subject to
payment of such fee, as may be prescribed.
(3) The Central Government may, on an application by the owner or agent
of any foreign ship, grant a certificate under sub-section (2) in respect of such
foreign ship on production of satisfactory evidence relating to maintenance of
insurance or other financial security in accordance with the provisions of the Civil
Liability Convention.
68 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
189. Any certificate granted by a competent authority in a State outside India
to a ship registered in that State or any certificate granted by a competent authority
of a State which is a contracting party to the Civil Liability Convention to any
ship wherever it is registered, shall be accepted at any port or place in India, as if
it were granted under this Act.
190. (1) No Indian vessel which has onboard more than two thousand tons
of oil in bulk as cargo shall enter or leave or attempt to enter or leave any port or
place in India unless it carries onboard a certificate granted under sub-section (2)
of section 188 or a certificate accepted under section 189.
(2) No ship other than an Indian vessel carrying more than two thousand
tons of oil in bulk as cargo, wherever registered, shall enter or leave or attempt
to enter or leave any port or place in India unless it carries onboard a certificate
granted under sub-section (2) of section 188 or a certificate accepted under
section 189.
(3) No proper officer shall grant inward entry or outward clearance to any
ship to which sub-section (1) or sub-section (2) applies, unless its master produces
a certificate required in respect of such ship.
191. (1) The insurer or other person providing financial security for the
ship owner’s liability for pollution damage may be directly liable for any
claim for compensation for such damage which may be brought directly
against such insurer or other person.
(2) The insurer or other person providing financial security against whom a
claim is made directly may, even if the owner is not entitled to limit his liability
under section 181, avail himself such limits of liability as specified in the said
section.
(3) The insurer or other person providing financial security may further avail
himself of the defences (other than the bankruptcy or winding up of the company)
which the ship owner himself would have been entitled to invoke and such insurer
or other person may avail himself of the defence that the pollution damage
resulted from the wilful misconduct of the ship owner himself but such insurer or
other person shall not avail himself of any other defence which he might have
been entitled to invoke in the proceedings brought by the ship owner against him.
(4) The insurer or other person providing financial security shall in any case
have the right to require the ship owner to be joined in the proceedings.
(5) Any sum provided by insurance or by other financial security maintained
in accordance with section 188 shall be available exclusively for the satisfaction
of claims under this Chapter.
192. (1) Any judgment passed by a competent court of contracting party
under the Civil Liability Convention shall be recognised in India, except where,—
(a) the judgment was obtained by fraud; or
(b) the ship owner or the insurer or the person providing financial
security who is a party to the proceedings was not given reasonable notice
and a fair opportunity to present his case.
(2) Any judgment recognised under sub-section (1) shall be enforceable in
India in accordance with such procedure as may be prescribed:
Provided that such procedure shall not permit the merits of the case to be
re-opened.
193. (1) The rights of compensation under this Chapter shall be extinguished
unless action is brought within a period of—
Acceptance of
certificate
granted outside
India.
Ban on entering
or leaving an
Indian port
without
certificate.
Direct action
against insurer
or other person
providing
financial
security.
Recognition of
judgment of
court of
contracting
parties to Civil
Liability
Convention.
Limitation
period.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 69
Government
ships.
Power to make
rules.
Application of
this Chapter.
Definitions.
(a) three years from the date of occurrence of pollution damage; and
(b) six years from the date of the incident which caused pollution
damage.
(2) If the incident consists of a series of occurrences, the period of six years
shall commence from the date of the first occurrence.
194. Nothing in this Chapter shall apply to any warship or any ship for the
time being used by the Government of any State for purposes other than
commercial purposes.
195. (1) The Central Government may make rules to carry out the provisions
of this Chapter.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the time and manner of constitution of the limitation fund under
sub-section (1) of section 182;
(b) the time and other particulars of the notice under sub-section (1)
of section 183;
(c) the procedure for establishment of fund and adjudication of claims
arising from incidents of oil pollution under sub-section (4) of section 183;
(d) the threshold limit of tonnage of oil to be carried in bulk and the
limit of liability for pollution damage under the proviso to sub-section (1)
of section 188;
(e) the form, particulars and fee to be paid for the grant of a certificate
under sub-section (2) of section 188;
(f) the procedure for enforcement of judgement under sub-section (2)
of section 192;
(g) any other matter which is required to be or may be prescribed.
CHAPTER IV
CIVIL LIABILITY FOR BUNKER OIL POLLUTION DAMAGE
196. This Chapter shall apply to,—
(a) pollution damage caused due to escape or discharge of bunker oil
from every Indian vessel and from every ship other than an Indian vessel
while it is,—
(i) within the territory of India including territorial waters; or
(ii) at a port or a place in India or within the coastal waters, not
extending more than two hundred nautical miles from the baseline;
(b) preventive measures for preventing or minimising the pollution
damage,
but shall not apply to—
(a) warships, naval auxiliary or other vessels owned or operated by the
Government and used for the time being, only for non-commercial
purposes;
(b) pollution damage specified in Chapter III of this Part.
197. In this Chapter, unless the context otherwise requires,—
(a) “Bunker Convention” means the International Convention on Civil
Liability for Bunker Oil Pollution Damage, 2001;
70 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(b) “bunker oil” means any hydrocarbon mineral oil, including
lubricating oil, used or intended to be used for the operation or propulsion
of the ship, and any residues of such oil;
(c) “incident”, “person”, “pollution damage” and “preventive measures”
shall have the meanings respectively assigned to them in clauses (a), (c), (d)
and (e), of section 176;
(d) “registered owner” means the person or persons registered as the
owner of the ship or, in the absence of registration, the person or persons
owning the ship, and in the case of a ship owned by a State and operated by
a company which in that State is registered as the ship’s operator, “registered
owner” shall mean such company;
(e) “ship” means any sea-going vessel and sea borne craft of any type
whatsoever;
(f) “ship owner” means the owner, including the registered owner,
bareboat charterer, manager and operator of the ship.
198. (1) Save as otherwise provided in section 200,—
(a) where pollution damage is caused due to discharge or escape of
bunker oil onboard or originating from the ship, the ship owner shall be
liable for,—
(i) any pollution damage;
(ii) the cost of any reasonable measures taken for preventing or
minimising any pollution damage so caused or likely to be caused; and
(iii) any damage caused by any such preventive measure so taken:
Provided that where an incident consists of a series of occurrences
having the same origin, the ship owner shall be liable from the first of such
occurrences and where more than one person is liable, their liability shall be
joint and several;
(b) where there is a grave and imminent threat of damage being caused
outside a ship, the ship owner shall be liable for the cost of any measures
reasonably taken to prevent or minimise any such damage.
(2) Where any incident involving two or more ships occurs resulting in
pollution damage, the ship owners of all ships involved in such incident shall, unless
the damage is reasonably separable, be jointly and severally liable for such damage.
199. (1) No liability for pollution damage shall be incurred by the ship
owner under this Chapter, if he proves that such damage,—
(a) resulted from an act of war, hostilities, civil war, insurrection or a
natural phenomenon of an exceptional, inevitable and irresistible character; or
(b) was wholly caused by any act or omission done with an intent to
cause such damage by any person other than an employee or agent of the
ship owner; or
(c) was wholly caused by the negligence or other wrongful act of any
Government or other authority responsible for the maintenance of lights or
other navigational aids in the exercise of that function.
(2) If the ship owner proves that the pollution damage resulted wholly or
partially either from an act or omission done with intent to cause damage by the
person who suffered the damage or from the negligence of that person, then, he
shall be wholly or partially exonerated from his liability to such person.
Liability for
bunker oil
pollution.
Exemption from
liability.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 71
Right of ship
owner to
limitation of
liability.
Determination
of limitation of
liability.
Consolidation of
claims and
distribution of
amount.
Extinguishment
of right to claim.
Maintenance of
compulsory
insurance or
other financial
security.
Direct action
against insurer
or other person
providing
financial
security.
Grant of
certificate.
200. (1) The ship owner and the person providing insurance or other
financial security shall be entitled to limit his liability under this Chapter in respect
of any one or more incidents in accordance with the provisions of Chapter II of
this Part.
(2) The ship owner shall not be entitled to limit his liability, if it is proved
that the incident causing pollution damage occurred as a result of his personal act
or omission, committed or made with intent to cause such damage, or committed
recklessly and with knowledge that such damage is likely to result.
201. A ship owner who is alleged to have incurred a liability for bunker oil
pollution under section 198 or his insurer may make an application to the High
Court or the Central Government for determination of limitation of his liability in
accordance with the provisions of Chapter II of this Part.
202. The High Court or the Central Government may consolidate all
claims against the ship owner or his insurer who has deposited the amount under
section 201 and may distribute the amount amongst the claimants in accordance
with the provisions of section 170.
203. (1) The right to claim compensation under this Chapter shall be
extinguished, if such claim is not made within a period of—
(a) three years from the date of occurrence of damage; and
(b) six years from the date of incident which caused such damage.
(2) Where the incident consists of a series of occurrences, the period of six
years shall commence from the date of the first of such occurrence.
204. Every registered owner of a ship having gross tonnage of more than
one thousand tons shall, for the purpose of his liability for pollution damage under
this Chapter, maintain compulsory insurance coverage or such other financial
security, subject to such limits as may be specified under the Limitation of
Liability for Maritime Claims Convention.
205. (1) The insurer or other person providing financial security for the ship
owner’s liability for pollution damage may also be liable along with the ship
owner for any claim for compensation for such damage.
(2) The insurer or other person providing financial security may, if the ship
owner is not entitled to limit his liability in accordance with the provisions of
section 200, avail himself such limits of liability as may be prescribed.
(3) Any claim for compensation for pollution damage may be brought
directly against the insurer or other person providing financial security for the
registered ship owner’s liability for pollution damage and in such case, the insurer
or such person may invoke defences (other than bankruptcy or winding up of the
company) which the ship owner would have been entitled to invoke, including
limitation of liability under section 200:
Provided that the insurer or such person may invoke the defence that the
pollution damage resulted from the wilful misconduct of the ship owner but shall
not invoke any other defence which such insurer or person might have been
entitled to invoke in proceedings brought by the ship owner against such insurer
or person:
Provided further that the insurer or such person may make the ship owner a
party to such proceedings.
206. (1) The Central Government shall grant a certificate in respect of every
ship which maintains insurance or other financial security, in such form,
containing such particulars, subject to such conditions and on payment of such
fee, as may be prescribed.
72 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(2) Every certificate granted under sub-section (1) shall on expiry, be
renewed in such manner and on payment of such fee as may be prescribed.
207. (1) No ship shall enter or leave or attempt to enter or leave any port or
place to which this Chapter applies unless it carries onboard a certificate granted
under section 206.
(2) Any certificate granted by a competent authority in any State outside
India to a ship registered in that State or any certificate granted by a competent
authority of any State which is a contracting party to the Bunker Convention to
any ship wherever registered, shall be accepted at any port or place in India as if
it were granted under this Act.
(3) No proper officer shall permit inward entry or outward clearance to any
ship to which sub-section (1) or sub-section (2) applies unless the master of the
ship produces the certificate required in respect of such ship.
208. Nothing contained in this Chapter shall prejudice the right of recourse
that the ship owner may have against any other person in respect of his liability.
209. (1) Any judgment passed by a competent court of a contracting party
under the Bunker Convention shall be recognised in India except where,—
(a) the judgment was obtained by fraud; or
(b) the ship owner or the insurer or the person providing financial
security who is a party to the proceedings was not given reasonable notice
and a fair opportunity to present his case.
(2) Any judgment recognised under sub-section (1) shall be enforceable in
India in accordance with such procedure as may be prescribed:
Provided that such procedure shall not permit the merits of the case to be
re-opened.
210. (1) The Central Government may make rules to carry out the provisions
of this Chapter.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the limits of liability of the insurer or other person providing
financial security under sub-section (2) of section 205;
(b) the form of certificate, particulars, conditions and fee for issuance
of certificate under sub-section (1) of section 206;
(c) the manner of renewal of certificate and fees under sub-section (2)
of section 206;
(d) the procedure for enforcement of a judgment under sub-section (2)
of section 209;
(e) any other matter which is required to be or may be prescribed.
CHAPTER V
INTERNATIONAL OIL POLLUTION COMPENSATION FUND
211. This Chapter shall apply to pollution damage caused in the territory of
India, including the coastal waters, not extending more than two hundred nautical
miles from the baseline and to preventive measures, wherever taken, to prevent or
minimise such pollution damage.
212. (1) In this Chapter, unless the context otherwise requires,—
(a) “associated person” includes any subsidiary or commonly
controlled entity or such person as may be prescribed;
(b) “contributing oil” means crude oil and fuel oil.
Ban on entering
or leaving port
without
clearance.
Right of
recourse.
Recognition of
judgment of
court of
contracting
parties to
Bunker
Convention.
Power to make
rules.
Application of
this Chapter.
Definitions.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 73
Contribution to
Fund.
Contribution
payable by
persons to
Fund.
Explanation.—For the purposes of this clause,—
(i) “crude oil” means any liquid hydrocarbon mixture occurring
naturally in the earth whether or not treated to render it suitable for
transportation and includes crude oils from which certain distillate
fractions are removed (sometimes referred to as topped crudes) or to
which certain distillate fractions are added (sometimes referred to as
spiked or reconstituted crudes);
(ii) “fuel oil” means heavy distillates or residues from crude oil
or blends of such materials intended for use as a fuel for the production
of heat or power of a quality equivalent to the “American Society for
Testing and Materials’ Specification for Number Four Fuel Oil
(Designation D 396-69)”, or heavier;
(c) “Fund” means the International Oil Pollution Compensation Fund,
1992 established under Article 2 of the Fund Convention;
(d) “Fund Convention” means the International Convention on the
establishment of an International Fund for Compensation for Oil Pollution
Damage, 1992, including protocols, if any, to which India is a party;
(e) “guarantor” means any person providing insurance or other
financial security to cover the owner’s liability;
(f) “ton”, in relation to oil, means a metric ton.
(2) The words or expressions used in this Chapter but not defined shall have
the meanings respectively assigned to them in the Civil Liability Convention.
213. (1) All contributions to the Fund in respect of contributing oil carried
by sea to ports or terminal installations in India shall be payable in accordance
with Articles 10 and 12 of the Fund Convention.
(2) The provisions of sub-section (1) shall apply—
(a) whether or not the contributing oil is imported; and
(b) notwithstanding that contributions are payable to the Fund in
respect of carriage of the same contributing oil on a previous voyage.
(3) The person liable to pay contributions to the Fund shall be—
(a) in case of contributing oil which is being imported into India, the
importer; and
(b) in any other case, the person by whom the oil is received in India.
(4) A person shall not be liable to pay contributions to the Fund in respect
of the contributing oil imported or received by him in any year, if the aggregate
quantity of contributing oil so imported or received in a year by him and any
associated person does not exceed one lakh fifty thousand tons, or as may be
specified from time to time in the Fund Convention.
Explanation.—For the purposes of this section, “terminal installation”
means any site for the storage of oil in bulk which is capable of receiving oil from
waterborne transportation, including any facility situated offshore and linked to
such site.
214. (1) The contributions payable to the Fund by a person for any year shall
be,—
(a) such amount as may be determined under Article 12 of the Fund
Convention;
74 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(b) in such instalments, becoming due at such dates,
as may be notified under the Fund Convention and any amount due shall be payable
along with interest at a rate determined under Article 13 of the Fund Convention.
(2) The Central Government may require persons who are or may be liable
to pay contributions to the Fund under this Chapter to give financial security for
payment of contributions to the Central Government or the Fund.
215. (1) Where any person suffering pollution damage is unable to obtain
full and adequate compensation for the damage under the Civil Liability
Convention, the Fund shall be liable to pay compensation to such person, if,—
(a) no liability for the damage arises under the provisions of the Civil
Liability Convention; or
(b) the ship owner liable for the damage under the provisions of the
Civil Liability Convention is financially incapable of meeting his
obligations in full and any financial security that may be provided under that
Convention does not cover or is insufficient to satisfy the claims for
compensation for the damage and the person suffering damage has taken all
reasonable steps to pursue the legal remedies available to him; or
(c) the damage exceeds the ship owner’s liability under the Civil
Liability Convention.
(2) The expenses incurred or sacrifices made by the ship owner voluntarily
to prevent or minimise pollution damage shall be treated as pollution damage for
the purposes of this section.
(3) The Fund shall incur no obligation under sub-section (1) if,—
(a) it is proved that the pollution damage resulted from an act of war,
hostilities, civil war or insurrection or was caused by oil which has escaped or
been discharged from a warship or other ship owned or operated by a State and
used at the time of the incident, only on Government non-commercial service; or
(b) the claimant fails to prove that the damage resulted from an
incident involving one or more ship.
(4) If the Fund proves that the pollution damage resulted wholly or partly either
from an act or omission done with the intent to cause damage by the person who
suffered the damage or from the negligence of that person, the Fund may be
exonerated wholly or partly from its obligation to pay compensation to such person.
(5) The Fund shall in any event (except in respect of preventive measures),
be exonerated to the extent the ship owner may have been exonerated under the
Civil Liability Convention.
216. (1) The liability of the Fund under section 215 shall be subject to the
limits specified in Article 4 of the Fund Convention.
(2) Upon institution of a claim for compensation under this Chapter, the
High Court shall issue notice to the Fund and such Fund shall be entitled to
participate in the proceedings.
(3) No order shall be passed against the Fund by the High Court until the
Fund notifies the High Court that the amount of the claim may,—
(a) not be reduced; or
(b) be reduced to a specified amount and the liability of the Fund shall
be enforceable only for the reduced amount.
(4) The amount for which the Fund is liable under this Chapter shall be paid
in rupees and the mode and manner of converting such amount from Special
Drawing Rights into rupees shall be such as may be prescribed.
Liability of
Fund.
Limitation of
liability of
Fund.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 75
Power to call for
information.
Claims against
Fund and
jurisdiction of
courts.
Extinguishment
of claims.
217. (1) The Central Government may, for the purpose of transmitting
to the Fund, the names and addresses of the persons who under this Chapter
are liable to make contributions to the Fund every year and the quantity of
contributing oil in respect of which they are so liable, by notice, require any
such person to furnish such information, in such manner and within such
time, as may be specified therein.
(2) In proceedings by the Fund against any person for the recovery of
any contribution due to the Fund under section 214, the particulars contained
in any list transmitted by the Central Government to the Fund shall, so far
as those particulars are based on information obtained under this section, be
admissible as evidence of the facts stated therein, and so far as particulars
which are so admissible are based on information given by the person against
whom the proceedings are brought, shall be presumed to be accurate until
the contrary is proved.
(3) No person shall disclose any information which was furnished to or
obtained by him under this section unless the disclosure is made,—
(a) with the consent of the person from whom the information was
obtained;
(b) in connection with the compliance of this section;
(c) for the purpose of any legal proceedings arising out of this
section or of any report of such proceedings.
(4) A person who,—
(a) refuses or wilfully neglects to comply with a notice under this
section; or
(b) makes, while furnishing any information in compliance with
a notice under this section, any statement which he knows to be false
in a material particular, or recklessly makes any statement which is
false in a material particular,
shall be liable to penalty under this Act.
218. (1) Any claim against the Fund for compensation under this
Chapter shall be brought before the High Court.
(2) The Fund shall have the right to intervene as a party to any legal
proceedings instituted in the High Court against the ship owner or his
guarantor.
(3) Where a notice of proceedings is given to the Fund by the High
Court, any judgment given in the proceedings shall, after it has become final
and enforceable, become binding upon the Fund to the effect that the facts
and evidence in that judgment may not be disputed by the Fund on the
ground that it has not intervened in the proceedings.
219. Notwithstanding anything contained in any other law for the time
being in force, no action to enforce a claim against the Fund under this
Chapter shall be entertained by a High Court, unless—
(a) the action to enforce is commenced; or
(b) notice of action to enforce a claim against the ship owner or
his guarantor in respect of the pollution damage is given to the Fund,
within three years from the date when the damage occurred and six years
from the date of the incident that caused such damage.
76 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
220. In respect of any sum paid by a public authority in India or by the Fund
as compensation for pollution damage, that authority or the Fund shall acquire by
subrogation any rights which the person so compensated would have enjoyed
under the Fund Convention.
221. The Central Government may establish a fund for the pollution damage
exceeding the amount payable under this Part and the source of fund and manner
of disbursement of compensation from such fund shall be such as may be
prescribed.
222. (1) The Central Government may make rules to carry out the provisions
of this Chapter.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) subsidiary or commonly controlled entity or person under clause (a) of
sub-section (1) of section 212;
(b) the mode and manner of conversion of Special Drawing Rights to
rupees under sub-section (4) of section 216;
(c) the source of fund and manner of disbursement of compensation
from fund established under section 221;
(d) any other matter which is required to be or may be prescribed.
PART X
MARINE INCIDENT AND EMERGENCY RESPONSE
223. This Part shall apply to marine incidents occurring directly or in
connection with the operations of,—
(a) Indian vessels; and
(b) vessels other than Indian vessels which enter a port or offshore
terminal or place in India or within her coastal waters.
224. In this Part, unless the context otherwise requires,—
(a) “marine incident” means an event, or sequence of events,
occurring directly in connection with the operation of a vessel that
endangers, or if not corrected, would endanger the safety of the vessel, its
occupants or any other person or the environment and includes marine
violation, marine casualty, marine disaster, cyclones, storms or other
adverse weather events, very serious marine casualty and such other event
or sequence of events as may be notified by the Central Government;
(b)
“maritime emergency response” means a speedy action
undertaken in response to a marine incident to ensure minimum damage to
the vessel, passengers, seafarers, cargo and the marine environment by
mitigating, containing, restoring and providing relief against such marine
incident.
225. (1) The Central Government shall, by notification, appoint one or more
nodal authorities who shall administer and supervise the marine incidents and the
corresponding maritime emergency response.
(2) The nodal authority shall discharge its duties under the supervision and
control of the Central Government.
Subrogation and
right of
recourse.
Power of
Central
Government to
establish fund
for excess
claim.
Power to make
rules.
Application of
this Part.
Definitions.
Appointment of
nodal authority
for marine
incidents.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 77
Primary
response party.
Plans and
procedures for
response
mechanisms.
Powers of nodal
authority.
Maintenance of
compulsory
insurance or
other financial
security.
Power to make
rules.
Marine
casualties and
report thereof.
226. (1) The ship owner or master, seafarers of the concerned vessel and
such other persons as may be notified by the Central Government shall be the
primary response party responsible for engaging in maritime emergency response.
(2) The primary response party shall comply with all directions, advisories
or instructions issued by the concerned nodal authority for the respective class of
marine incidents.
227. The Central Government shall notify plans for prevention of marine
incidents and procedures for maritime emergency responses.
228. (1) Notwithstanding anything contained in any other law for the time
being in force, it shall be lawful for the nodal authority to issue directions in
writing, consistent with the objectives of this Part, to the administrative bodies
under the Central Government and the State Governments.
(2) The nodal authority may requisition the services of any officer of the
Central Government or the State Government or any police officer or any other
authority or body to assist for the purposes of this Part and it shall be the duty of
every such officer or authority or body to comply with such requisition.
(3) The nodal authority may requisition the resources and pollution
prevention equipment available with any of the offices of the Central Government
or the State Government or other offices or organisations to assist for the purposes
of this Part and it shall be the duty of such offices or organisations to comply with
such requisition.
(4) The circumstances under which the nodal authority shall carry out
maritime emergency response to a marine incident shall be such as may be
prescribed.
229. Every registered owner of an Indian vessel or any other vessels which
enter a port, shipyard or offshore terminal or place in India or within coastal
waters shall, for the purpose of covering his liability under this Part, maintain
adequate insurance coverage or such other financial security as may be prescribed,
and carry onboard a certificate or document showing compliance with such
requirement.
230. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the circumstances under which the nodal authority shall carry out
maritime emergency response to a marine incident under sub-section (4) of
section 228;
(b) adequate insurance coverage or other financial security under
section 229;
(c) any other matter which is required to be or may be prescribed.
PART XI
INVESTIGATION AND INQUIRIES ON MARINE CASUALTIES
231. (1) For the purposes of investigation and inquiries under this Part, a
marine casualty shall be deemed to be an event or sequences of events that has
resulted in any of the following and has occurred directly or in connection with
the operations of Indian vessels and any other vessels, when—
(a) on or near the coast of India, any vessel is lost, abandoned, stranded
or materially damaged;
78 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(b) on or near the coast of India, any vessel causes loss or material
damage to any other vessel or to external infrastructure;
(c) any loss of life or presumed loss of life ensues by reason of any
casualty happening or otherwise, onboard any vessel, on or near the coast
of India or its coastal waters;
(d) in any place, any such loss, abandonment, stranding, material
damage or casualty occurs to or onboard any Indian vessel and any
competent witness thereof is found in India;
(e) any Indian vessel is lost or is supposed to have been lost, and any
evidence is obtainable in India as to the circumstances under which such
vessel proceeded to sea or was last heard of;
(f) in any place within the coastal waters, pollution, or the potential
threat of such pollution to the environment, or severe damage to the
environment, or the potential to severe damage to the environment is caused
by a vessel;
(g) a fire or explosion takes place on any Indian vessel anywhere in
the world, or a fire or explosion takes place on a vessel other than an Indian
vessel, while such vessel is on or near the coast of India or its coastal
waters.
(2) In the cases mentioned in sub-section (1), the ship owner, manager,
operator, company, pilot, harbour master, master, or other person in charge of the
vessel or where two vessels are concerned, in charge of each vessel at the time of
the marine casualty shall, within twenty-four hours of the occurrence, give notice
of the marine casualty to the officer appointed in this behalf by the Central
Government.
(3) Wherever any such officer receives notice of the marine casualty under
sub-section (2), he shall forthwith inform in writing to the Central Government
and proceed to make preliminary inquiry into the marine casualty.
(4) The officer referred to in sub-section (3) shall, on completion of
preliminary inquiry, furnish the report to the Central Government or other
authority as may be appointed by it in this behalf.
(5) The Central Government may, for the purposes of the investigation,
appoint a body to conduct marine safety investigation in accordance with the
Safety Convention.
(6) The body appointed under sub-section (5) shall make preliminary
assessment of the marine casualty and conduct a marine safety investigation for
ascertaining the causes and circumstances of such marine casualty and submit its
report to the Central Government.
Explanation.—For the purposes of this Part, “company” shall have the same
meaning as assigned to it in clause (a) of section 115.
232. On receipt of the marine safety investigation report under sub-section (6)
of section 231, or if the Central Government is of the opinion that prima facie,
there exists incompetency, misconduct or violation of any law for the time being
in force on the part of any person, it may—
(a) initiate administrative action; and
(b) direct such officer or other authority having jurisdiction over the
area to initiate proceedings against such person as may be required in
accordance with such law.
Power of
Central
Government to
initiate
proceedings.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 79
Application of
this Chapter.
Definitions.
PART XII
WRECK AND SALVAGE
CHAPTER I
WRECK
233. This Chapter shall apply to the wrecks located within the territory of
India including the coastal waters but shall not apply to,—
(a) any measures taken under the International Convention relating to
the Intervention on the High Seas in Cases of Oil Pollution Casualties, 1969;
(b) any warship or other vessel owned or operated by the Government
for non-commercial service.
234. In this Chapter, unless the context otherwise requires,—
(a) “authority” means the Central Government or any person
authorised by it;
(b) “Convention” means the Nairobi Convention on the Removal of
Wrecks, 2007;
(c) “hazard” means any condition or threat, that—
(i) poses a danger or impediment to navigation; or
(ii) may reasonably be expected to result in major harmful
consequences to the marine environment or damage to the coastline or
related interests of India or any other State.
Explanation.—For the purposes of this clause, “related interest”
means—
(i) maritime coastal, port and estuarine activities including
fisheries activities, constituting essential means of livelihood of the
persons concerned;
(ii) tourist attractions and other economic interests of the areas
concerned;
(iii) the health of the coastal population and the well-being of the
area concerned, including conservation of marine living resources and
of wildlife; and
(iv) offshore and underwater infrastructure;
(d) “maritime casualty” means a collision of ships, stranding or other
incident of navigation or other occurrence onboard a ship or external to it,
resulting in material damage or imminent threat of material damage to a ship
or its cargo;
(e) “operator of ship” means the ship owner or any other organisation
or person such as the manager or the bareboat charterer, who has assumed
the responsibility for operation of the ship from the ship owner and has
agreed to take over the duties and responsibilities enshrined under the
International Safety Management Code;
(f) “receiver of wreck” means a person appointed as such under
sub-section (1) of section 235;
(g) “registered owner” means,—
(i) the person registered as the owner of the ship or in the absence
of registration, the person owning the ship at the time of the maritime
casualty;
80 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(ii) in the case of a ship owned by a State and operated by a
company which in that State is registered as the operator of the ship;
(h) “removal” means any form of prevention, mitigation or
elimination of the hazard created by a wreck and the expressions “remove”,
“removed” or “removing”, shall be construed accordingly;
(i) “ship” means a sea-going vessel of any type whatsoever and
includes hydrofoil boats, air-cushion vehicles, submersibles, floating craft
and floating platforms, except when such platforms are on location engaged
in the exploration, exploitation or production of seabed mineral resources.
235. (1) The Central Government may, by notification, appoint any person
to be a receiver of wreck who shall receive and take possession of wreck and
perform his duties under this Chapter, within such local limits as may be specified
in that notification.
(2) The duties of a receiver of wreck shall include disposal or sale of the
wreck, giving of notices, enforcing performance of obligations by ship owner,
operator or insurer of the ship, and to take such action as required to remove the
wreck by the most practical and expeditious means available, consistent with
considerations of safety and protection of maritime environment.
236. (1) When any Indian vessel or any ship other than an Indian vessel, is
involved in a maritime casualty resulting in a wreck in any area to which this
Chapter applies, the master or ship owner or the operator of the ship shall, without
any delay report such incident to the Director-General and the Maritime Rescue
Coordination Centre or the Maritime Rescue Sub-Centre of Indian Coast Guard.
(2) When any Indian vessel is involved in a maritime casualty resulting in a
wreck in a convention area of any State, the master and the operator of that ship
shall, without any delay, report such incident to the affected State in such manner
as may be required by that State and shall also report such incident to the
Director-General and the Maritime Rescue Coordination Centre or the Maritime
Rescue Sub-Centre of Indian Coast Guard.
Explanation.—For the purposes of this sub-section,—
(i) “affected State” means the country in whose convention area the
wreck is located;
(ii) “convention area” means the Exclusive Economic Zone of a State
party established in accordance with international law or, if a State party has
not established such a zone, an area beyond and adjacent to the territorial
sea of that State determined by that State in accordance with international
law and extending not more than two hundred nautical miles from the
baseline from which the breadth of its territorial sea is measured.
237. The Central Government shall determine whether a wreck constitute a
hazard or not, based on the following criteria, namely:—
(a) the type, size and construction of the wreck;
(b) the depth of water in the area;
(c) the tidal range and currents in the area;
(d) the proximity to protected areas including coral reefs and other
areas as may be notified by the Central Government;
(e) the sensitive sea areas identified as appropriate and designated in
accordance with guidelines adopted by the International Maritime
Organisation, or a clearly defined area of the Exclusive Economic Zone
where special mandatory measures are adopted in accordance with
requirements of the United Nations Convention on the Law of the Sea, 1982;
Receiver of
wreck.
Duty to report
wrecks.
Determination
of hazard.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 81
Locating and
marking of
wrecks.
Power to pass
over adjoining
lands.
Prohibition of
certain acts in
respect of
wreck.
(f) the proximity of shipping routes or established traffic lanes;
(g) the traffic density and frequency;
(h) the type of traffic;
(i) the nature and quantity of the wreck’s cargo, the amount and types
of oil (such as bunker oil and lubricating oil) onboard the wreck and in
particular, the damage likely to result if the cargo or oil is released into the
marine environment;
(j) the vulnerability of port and port facilities;
(k) the prevailing meteorological and hydrographical conditions;
(l) the submarine topography of the area;
(m) the height of the wreck above or below the surface of the water at
lowest astronomical tide;
(n) the acoustic and magnetic profiles of the wreck;
(o) the proximity of offshore installations, pipelines, telecommunication
cables and similar structures;
(p) the proximity of tourist spots and heritage locations; and
(q) any other criteria as may be prescribed.
238. (1) When a wreck is determined to be a hazard, it shall be the duty of
the ship owner or the operator of such a ship, to—
(a) immediately mark the wreck at his or its own cost in such manner
as may be prescribed; and
(b) maintain the marking until the wreck is removed.
(2) The cost for locating and marking the ship shall be borne by or recovered
from the ship owner or the operator of such a ship.
239. (1) Whenever a ship is wrecked, stranded or in distress, all persons
may, for the purpose of rendering assistance to the ship or of saving the lives of
the shipwrecked persons, or of saving the cargo or equipment of the ship, unless
there is some public road equally convenient, pass and repass, either with or
without vehicles or animals, over any adjoining lands without being subject to
interruption by the owner or occupier of the land, so that they do as little damage
as possible and may also on the like condition, deposit on these lands any cargo
or other article recovered from the ship.
(2) Any damage sustained by an owner or occupier as a consequence of the
exercise of the rights under this section shall be a charge on the ship, cargo or
articles in respect of or by which the damage is sustained and in case of dispute,
the amount payable in respect of such damage shall be determined by a Magistrate
on an application made to him in this behalf.
240. No person shall,—
(a) without the leave of the master, board or attempt to board any ship
which is wrecked, stranded or in distress, unless the person acts by
command of the Central Government; or
(b) impede or hinder or attempt in any way to impede or hinder the
saving of any ship stranded or in danger of being stranded or otherwise in
distress in any area to which this Chapter applies or of any part of the cargo
or equipment of the ship, or of any wreck; or
(c) release any wreck or deface or obliterate any marks thereon; or
82 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(d) wrongfully carry away or remove any part of a ship stranded or in
danger of being stranded or otherwise in distress or any part of the cargo or
equipment of the ship or any wreck, in any area to which this Chapter
applies.
241. Where a receiver of wreck suspects or receives information that any
wreck is released or is in the possession of some person who is not the owner
thereof or that any wreck is otherwise improperly dealt with, he may apply to the
nearest Judicial Magistrate of the first class for a search warrant and such
Magistrate shall have power to grant the warrant and the receiver of wreck by
virtue thereof may enter any house or other place wherever situate and also any
ship and search for, seize and detain any such wreck found thereof.
242. (1) When it is determined that the wreck constitutes a hazard, the
receiver of wreck shall give the detailed information of the hazard to the Central
Government, in such manner as may be prescribed.
(2) The Central Government, on receipt of information under sub-section (1)
shall,—
(a) inform the Government of the State in which the ship is registered
as well as the registered ship owner; and
(b) consult such State and any State affected by the wreck regarding
measures to be taken in relation to such wreck.
(3) The registered ship owner or the operator of the ship shall remove such
wreck which is determined to constitute a hazard:
Provided that where any dispute arises as to whether the wreck constitutes
a hazard or not, the decision of the Central Government shall be final and binding
on all parties.
(4) When a wreck is determined to constitute a hazard, the registered ship
owner or any interested person shall provide to the Central Government or the
receiver of wreck with the evidence of insurance or other financial security
maintained by him in accordance with the provisions of this Act.
(5) The receiver of wreck or ship owner or operator of the ship shall submit
a plan for removal of wreck to the Central Government.
(6) The Central Government shall approve or disapprove or approve with
certain modifications, the plan submitted before it under sub-section (5) and
having regard to the nature of the hazard, specify on a case to case basis, the time
within which the ship owner or operator shall remove the wreck.
(7) If the ship owner or operator do not remove the wreck within the time
specified under sub-section (6), the Central Government may, at the expense of
such ship owner or operator, remove the wreck by the most practical and
expeditious means available, consistent with considerations of safety and
protection of the marine environment and the wreck or any sale proceeds derived
from such wreck shall become the property of the Central Government.
(8) Where immediate action is required and the receiver of wreck has
informed the ship owner or the operator accordingly, he may, at the expense of
such ship owner or operator, remove the wreck by the most practical and
expeditious means available, consistent with considerations of safety and
protection of the marine environment.
(9) Where any measure taken under this section is construed to be salvage,
the provisions of Chapter II of this Part relating to salvage shall apply.
Search warrants
where wreck is
involved.
Measures to
facilitate
removal of
wrecks.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 83
Liability of ship
owner.
Maintenance of
insurance or
other financial
security.
243. (1) The registered ship owner shall be liable for the costs of locating,
marking and removing the wreck under this Chapter unless he proves that the
maritime casualty which caused the wreck—
(a) resulted from an act of war, hostilities, civil war, insurrection, or a
natural phenomenon of an exceptional, inevitable and irresistible character; or
(b) was wholly caused by act or omission done with an intent to cause
damage by a third party; or
(c) was wholly caused by the negligence or other wrongful act of any
Government or other authority responsible for the maintenance of lights or
other navigational aids in the exercise of that function.
(2) Nothing contained in this Chapter shall—
(a) affect the right of the registered ship owner to limit his liability in
accordance with the provisions of section 162; or
(b) prejudice any right of recourse available to the registered ship
owner against third parties.
(3) Notwithstanding anything contained in this section, the registered ship
owner shall not be liable for any cost, if, and to the extent that liability or such
costs is in conflict with—
(a) any other provisions of this Act;
(b) the provisions of the Civil Liability for Nuclear Damage Act, 2010; or
(c) any other international legal instrument to which India is a party.
244. (1) Every registered owner of an Indian vessel of gross tonnage of
three hundred and above shall, for the purposes of covering his liability under this
Chapter, be required to maintain compulsory insurance coverage or such other
financial security, as may be prescribed.
(2) Every ship owner or operator of a ship other than an Indian vessel of gross
tonnage of three hundred and above, while it is in the area to which this Chapter
applies, shall maintain insurance coverage or other financial security to cover his
liability under the Convention and shall carry onboard a certificate to that effect.
(3) The certificate referred to in sub-section (2) shall, in case the ship is,—
(a) registered in India, be granted by the authority;
(b) registered in a Convention State other than India, be granted by or
under the authority of the Government of that State; and
(c) registered in a State which is not a Convention State, be granted or
certified by the appropriate authority authorised by any Convention State.
(4) Any ship which contravenes the provisions of sub-section (2), shall be
liable to be detained by the authority.
(5) Any claim for costs arising under this Chapter may be brought directly
against the insurer or other person providing financial security for the registered
ship owner’s liability and in such a case, the insurer or such person may invoke
defences (other than bankruptcy or winding up of the company) which the
registered ship owner would have been entitled to invoke, including limitation of
liability as provided under this Act:
Provided that where the registered ship owner is not entitled to limitation of
liability under this Act, the insurer or such person may limit liability to an amount
equal to the amount of the insurance or other financial security required to be
maintained under sub-section (1):
38 of 2010.
84 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
Provided further that the insurer or such person may invoke the defence that
the maritime casualty resulted from the wilful misconduct of the registered ship
owner but shall not invoke any other defence which such insurer or person might
have been entitled to invoke in proceedings brought by the registered ship owner
against such insurer or person:
Provided also that the insurer or such person shall have the right to require
the registered ship owner to be joined in such proceedings.
245. (1) The owner of any wreck in the possession of the receiver, upon
establishing his claim to the satisfaction of the receiver within one year from the
time at which the wreck came into the possession of the receiver shall, upon
paying the salvage and other charges, be entitled to have the wreck or the proceeds
thereof delivered to him.
(2)Where any articles belonging to or forming part of a ship other than an Indian
vessel which is wrecked or belonging to and forming part of the cargo of such ship,
are found in any area to which this Chapter applies or are brought into any port in
India, the ambassador of the State in which the ship is registered or, in the case of
cargo, the State to which the owners of the cargo may have belonged shall, in the
absence of the owner and of the master or other agent of the owner, be deemed to be
the agent of the owner, with respect to the custody and disposal of the articles.
(3) Where the owner of the wreck does not appear and claim the balance of
the proceeds of sale within one year from the date of sale, the said balance shall
become the property of the Central Government.
246. Any claim for recovery of costs for locating and marking of the ship under
this Chapter shall be made within a period of three years from the date of determination
of the hazard and six years from the date the maritime casualty resulted in the wreck:
Provided that where the maritime casualty consists of a series of occurrences,
the six years period shall be reckoned from the date of the first occurrence.
CHAPTER II
SALVAGE
247. (1) This Chapter shall apply to—
(a) salvage operations within the territory of India including the
coastal waters; and
(b) judicial or arbitral proceedings relating to salvage operations in
respect of a vessel or any other property which are instituted in India.
(2) This Chapter shall not apply to—
(i) the fixed or floating platforms or mobile offshore drilling units when
such platforms or units are on location engaged in the exploration, exploitation
or production of seabed mineral resources;
(ii) warships or other non-commercial vessels owned or operated by the
Government which are entitled, at the time of salvage operations, to sovereign
immunity;
(iii) such vessels as the Central Government may, by notification, specify.
(3) This Chapter shall apply, notwithstanding that the vessel undertaking the
salvage operations belong to the same owner of the vessel being salvaged.
248. In this Chapter, unless the context otherwise requires,—
(a) “damage to the environment” means substantial physical damage
to human health or to marine life or resources in coastal or inland waters or
areas adjacent thereto caused by pollution, contamination, fire, explosion or
similar major incidents;
Claims of ship
owners to
wreck.
Extinguishment
of right to claim
recovery of
costs.
Application of
this Chapter.
Definitions.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 85
Salvage payable
for saving life,
cargo or wreck.
Salvage
operations
controlled by
Government or
port and public
authorities.
Salvage
contracts.
Duties of salvor,
owner and
master.
(b) “payment” means any reward, remuneration or compensation due
under the Salvage Convention;
(c) “property” means any property not permanently and intentionally
attached to the shoreline and includes freight at risk;
(d) “vessel” means any ship or craft, or any structure capable of
navigation.
249. (1) Where services are rendered by any master or salvor or any person
other than the authority notified by the Central Government,—
(a) wholly or in part within the territorial waters of India in saving life
from any vessel, or elsewhere in saving life from a vessel registered in India; or
(b) in assisting a vessel or saving the cargo or equipment of a vessel which
is wrecked, stranded or in distress at any place to which this Chapter applies; or
(c) in saving any wreck,
there shall be payable to such master or salvor or person by the owner of the
vessel, cargo, equipment or wreck, a reasonable sum for salvage having regard to
all the circumstances of the case.
(2) A master or person or salvor rendering salvage under clause (a) of
sub-section (1) shall be entitled to a fair share of the payment for the salvage of
the vessel or other property or preventing or minimising damage to the
environment.
(3) Salvage in respect of the preservation of life when payable by the owner
of the vessel shall be payable in priority to all other claims for salvage.
250. Where salvage operations are rendered by or on behalf of the
Government or by a vessel of the Indian Navy or of the Coast Guard or the
commander or crew of any such vessel or the port authorities or any public
authority, the Government or other authority acting on its behalf shall be entitled
to salvage and payment for such services as provided under this Chapter and shall
have the same rights and remedies in respect of those services as any other salvor.
251. (1) The owner of a vessel or the master on behalf of the owner shall
conclude contracts with salvors to undertake necessary and adequate salvage
operations in compliance with the provisions of this Chapter.
(2) The master or the owner of the vessel shall have the authority to conclude
such contracts on behalf of the owner of the property onboard the vessel.
252. (1) The salvor shall have the following duties towards the owner of the
vessel or other property in danger, namely:—
(a) to carry out the salvage operations with due care;
(b) to exercise due care to prevent or minimise damage to the environment
during salvage operations;
(c) to seek assistance from other salvors including port authorities or
public authorities when circumstances so require;
(d) to coordinate with the Director-General and act in compliance with
the instructions issued by him; and
(e) to accept the intervention of other salvors when reasonably requested to
do so by the owner or master of the vessel or other property in danger:
Provided that if it is found that such a request was unreasonable, it shall not
prejudice the amount of reward of such salvor.
(2) The owner or master of the vessel or the owner of other property which
is in danger shall have the following duties towards the salvor, namely:—
(a) to cooperate with the salvor during the course of the salvage
operations;
86 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(b) to exercise due care to prevent or minimise damage to the
environment during the salvage operations;
(c) when the vessel or other property is brought to a place of safety, to
accept redelivery when reasonably requested by the salvor; and
(d) to provide satisfactory security for the claim, including interest and
costs of the salvor for the salvage operations, at the request of the salvor.
253. (1) A salvor shall have a right to payment for the services rendered by
him relating to salvage operations:
Provided that no such payment shall be made where there is express and
reasonable prohibition from rendering any such service by the owner or master of
vessel or owner of any other property in danger which is not and has not been
onboard the vessel.
(2) The criteria for claiming rewards, manner of fixing rewards, payment of
special compensation under Article 14 of the Salvage Convention, apportionment
of payment amongst salvors, salvage of persons, payment under the contract,
payment for additional services not covered under the contract and effect of
misconduct of salvors on reward or payment under this Chapter shall be such as
may be prescribed.
(3) The salvor shall have right to enforce his maritime lien against the ship
owner or master of vessel or owner of any other property in danger when
satisfactory security for his claim, including interest and costs, is not provided by
such ship owner or master or owner.
254. (1) The Central Government shall take such measures as may be
necessary to protect its coastline or related interests from pollution or threat of
pollution arising out of a maritime casualty or acts relating to such casualty which
may result in major harmful consequences.
(2) The Central Government may give such directions as it deems fit to the
ship owner or the master or the salvor or a port authority or a public authority or
any other person in relation to salvage operations.
(3) The Central Government may, for the purposes of efficient and effective
salvage operations, saving life or property in danger and preventing damage to
the environment, seek cooperation from the concerned ship owner or the master
or the salvor or a port authority or a public authority or any other person, to give
assistance to vessel in need, to admit to ports of vessel in distress or in need of
assistance and to give facilities to salvors.
(4) The circumstances under which the salvage operation shall be exercised
by the Central Government shall be such as may be prescribed.
255. The Central Government may, for the purposes of this Chapter, notify
a list of salvors having such qualifications and experience and subject to such
terms and conditions as may be prescribed.
256. The ship owner and salvor may, for the redressal of grievances relating
to this Part, approach the Director-General who shall assist the parties in an
independent and impartial manner to enable an amicable settlement in accordance
with such procedure as may be prescribed.
257. (1) Either party to the salvage contract shall prefer an arbitration for a
dispute that is not resolved by the Director-General under section 256:
Provided that where the salvage contract does not provide for the resolution
of disputes by arbitration, the disputes shall be adjudicated in accordance with the
salvage contract.
Rights of
salvors.
Powers and
duties of Central
Government in
relation to
salvage
operations.
Retention of
salvors.
Disputes
between ship
owner and
salvor.
Adjudication of
disputes
between ship
owner and
salvor.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 87
Extinguishment
of claims.
Savings.
Power to make
rules.
Application of
this Part.
(2) Any person aggrieved by the arbitral award may appeal to the concerned
High Court in accordance with the applicable law.
(3) Any dispute involving more than one claimant to the salvage amount
shall be decided by the High Court.
(4) The High Court may, by interim order, direct that the salvor shall be paid
such amount as may appear to it to be fair and just.
258. Any action relating to payment under this Chapter shall extinguish if
no action for such claim is made within a period of two years from the date of
completion of salvage operations.
259. Nothing in this Part shall,—
(a) affect any treaty or arrangement with any foreign State to which
India is a party with reference to the disposal of the proceeds of wrecks on
their respective coasts; or
(b) entitle any person to salvage under this Act in respect of any
property recovered by creeping or sweeping in contravention of the Indian
Ports Act, 1908.
260. (1) The Central Government may make rules to carry out the provisions
of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(a) the other criteria to determine whether a wreck constitute a hazard
or not under clause (q) of section 237;
(b) the manner of marking wreck under clause (a) of sub-section (1)
of section 238;
(c) the manner of giving detailed information of the hazard to the
Central Government under sub-section (1) of section 242;
(d) the other financial security under sub-section (1) of section 244;
(e) the criteria for claiming rewards, manner of fixing rewards,
payment of special compensation, apportionment of payment and the effect
of misconduct of salvors on reward or payment under sub-section (2) of
section 253;
(f) the circumstances in which salvage operation shall be exercised by
the Central Government under sub-section (4) of section 254;
(g) the qualification, experience and the terms and conditions subject
to which salvors shall be notified under section 255;
(h) the procedure in accordance with which the Director-General shall
settle the dispute under section 256;
(i) any other matter which is required to be or may be prescribed.
PART XIII
SAILING, FISHING AND OTHER VESSELS
261. Save as otherwise provided, nothing contained in this Act, except the
provisions of this Part, Part I, Part II, Part III, Part XI and Part XIV, shall apply
to vessels of the following description, namely:—
(a) sailing vessel;
(b) fishing vessel;
15 of 1908.
88 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(c) vessel whose net tonnage is less than fifteen and is engaged solely
in the coasting trade of India:
Provided that the Central Government may, by notification, direct that any
other provisions of this Act shall also apply to such vessels subject to such
conditions, exceptions and modifications as may be specified in that notification.
Explanation.—For the purposes of this section, “coasting trade of India”
means,—
(i) the carriage by sea of goods or passengers or both from any port or
place in India to any other port or place in India; or
(ii) performing any service within the waters in the jurisdiction of
India, including any part of the adjoining maritime zones of India within the
meaning of the Territorial Waters, Continental Shelf, Exclusive Economic
Zone and other Maritime Zones Act, 1976, or any other law for the time
being in force or any port or place, including inland ports, as the Central
Government may, by notification, specify in this behalf.
262. In this Part, unless the context otherwise requires,—
(a) “C-188 Convention” means the C-188-Work in Fishing Convention
adopted by the International Labour Conference of the International Labour
Organisation and signed in Geneva on the 14th day of June, 2007;
(b) “Indian fishing vessel” means a fishing vessel registered as an
Indian vessel under section 15;
(c) “skipper” means the person having the command of a fishing
vessel;
(d) “Standards of Training, Certification and Watchkeeping for
Fishing Vessel Personnel Convention” means International Convention on
Standards of Training, Certification and Watchkeeping for Fishing Vessel
Personnel, 1995, signed in London on the 7th day of July,1995.
263. (1) If any question arises as to whether a vessel falls under this Part, it
shall be decided by the Director-General and his decision thereon shall be final.
(2) Where the question under sub-section (1) relate to a fishing vessel, the
decision shall be made in such manner as may be prescribed.
264. (1) Every vessel covered under this Part shall be manned and carry
onboard such fittings, material, appliances and apparatus, for safety, security and
prevention of pollution, as may be prescribed:
Provided that in case of fishing vessels, such rules shall take into consideration
the provisions of such international conventions and standards or parts thereof, as
may be deemed necessary by the Central Government, including the Cape Town
Agreement and C-188 Convention.
(2) Every owner of a vessel to which this Part applies, shall provide such
policy of insurance as may be prescribed, for all persons employed as members
of the crew of such vessel, against death or personal injury caused by accident
arising in the course of their employment, for an amount which shall not be less
than the amount specified by the Central Government.
(3) No vessel shall ply or proceed to sea unless it complies with the
provisions of this section.
Explanation.—For the purposes of this section, “Cape Town Agreement”
means the Cape Town Agreement of 2012 on the Implementation of the
Provisions of the 1993 Protocol relating to the Torremolinos International
Convention for the Safety of Fishing Vessels, 1977 signed in Cape Town on the
11th day of October, 2012.
Definitions.
Decision of
question
whether a vessel
falls under this
Part.
Requirements
for safety,
security,
prevention of
pollution and
insurance.
80 of 1976.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 89
Manning of
fishing vessels.
Central
Government to
grant certificate
of proficiency.
Training for
grant of
certificate of
competency and
certificate of
proficiency.
Examination for
grant of
certificate.
265. (1) The Central Government may make rules to provide for the
following matters, taking into consideration the Standards of Training,
Certification and Watchkeeping for Fishing Vessel Personnel Convention as may
be deemed necessary, namely:—
(a) the manning scale of every Indian fishing vessel and different
manning scales for different categories of Indian fishing vessels, areas and
types of fishing operations;
(b) the grade of certification to be held by every fisher appropriate to
his station, serving onboard an Indian fishing vessel.
(2) Subject to such conditions and restrictions as may be prescribed, an
Indian national with certificate of competency granted under the law for the time
being in force of another State or foreign national with certificate of competency
granted under this Act or another State, may serve on an Indian fishing vessel.
(3) Subject to the provisions of the Standards of Training, Certification and
Watchkeeping for Fishing Vessel Personnel Convention, as applicable, every
fishing vessel, whether at sea or in any port or place, shall be manned by such
number of persons with such qualifications and such other requirements as may
be prescribed.
266. (1) The Central Government shall, subject to the provisions of the
Standards of Training, Certification and Watchkeeping for Fishing Vessel
Personnel Convention, grant certificate of competency or certificate of
proficiency for such different grades of fishers with such requirements and in such
manner as may be prescribed.
(2) No certificate of competency or certificate of proficiency shall be
granted under sub-section (1), unless the fisher fulfils the qualifications and other
requirements referred to in sub-section (3) of section 265.
(3) Notwithstanding anything contained in sub-sections (1) and (2), the
Central Government may grant such other certificate of competency or certificate
of proficiency with such requirements and in such manner as may be prescribed.
(4) A certificate of competency or certificate of proficiency shall be granted
in such form, on payment of such fee and be valid for such period, as may be
prescribed.
267. (1) The Director-General shall administer, supervise and monitor all
activities relating to training and assessment for the grant of certificate of
competency or certificate of proficiency under this Part.
(2) The Director-General shall approve the training institute, training course
and method of conduct of such training for the grant of certificate of competency
or certificate of proficiency in accordance with such criteria as may be prescribed.
268. (1) The Director-General or a person duly authorised by the
Director-General in this behalf shall appoint such person or persons for the purpose
of examining the persons desirous of obtaining certificate of competency or
certificate of proficiency.
(2) No certificate referred to in sub-section (1) may be granted to any
applicant, unless such applicant is duly reported by the examiner to have
satisfactorily passed the examination.
(3) Subject to the provisions of the Standards of Training, Certification and
Watchkeeping for Fishing Vessel Personnel Convention, the form and manner of
conduct of examination for the purposes of grant of certificate of competency or
certificate of proficiency and the fee payable therefor, shall be such as may be
prescribed.
90 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
269. Where it appears to the Central Government that a person holding
certificate of competency or certificate of proficiency has obtained it on the basis
of false or erroneous information, or is guilty of misconduct, or on receipt of any
report of incompetency, or any act of omission or commission or compromise to
safety, security or prevention of pollution by the person holding such certificate
which may threaten or pose a threat to life or property or environment, it may,
after due investigation, by order, withdraw, suspend or cancel such certificate:
Provided that no order shall be passed under this section without giving to
the holder of such certificate a reasonable opportunity of being heard.
270. The owner, master, tindal or skipper of every vessel shall, on demand,
produce to the proper officer the certificate of competency or certificate of
proficiency or any other certificate specified under this Act or the rules made
thereunder.
271. Subject to the provisions of C-188 Convention, as the Central
Government may deem necessary,—
(a) the owner or his agent or skipper of an Indian fishing vessel shall
enter into an agreement in such form and manner as may be prescribed, with
every fisher whom he engages to man the vessel and shall submit a copy
thereof to the person or authority as may be notified by the Central
Government;
(b) a fisher’s right to wages and provisions shall begin either at the
time he commences work or at the time specified in the agreement or
presence onboard, whichever is earliest;
(c) a fisher engaged under this section shall not,—
(i) by any agreement forfeit his lien on the fishing vessel; or
(ii) be deprived of any remedy for the recovery of his wages to
which, in the absence of the agreement, he shall be entitled; or
(iii) by any agreement abandon his right to wages in case of the
loss of the fishing vessel; or
(iv) abandon any right that he may have or obtain in the nature
of salvage,
and every agreement inconsistent with the provisions of this Act shall be void.
272. The Central Government may, by notification, require every Indian
fishing vessel or any specified class of Indian fishing vessels to furnish fishery
data to the Registrar in such form and at such periodical intervals as may be
specified in that notification.
273. (1) No vessel shall ply or proceed to sea unless it is in possession of
such certificates granted under this Part in such manner and for such period as
may be prescribed.
(2) Every certificate shall be granted in such manner and shall be in force
for such period as may be prescribed:
Provided that where a vessel is not at a port at the time of expiry of the
certificate, the owner, master, tindal or skipper of that vessel shall notify the
Central Government of such expiry, and the certificate shall continue to be valid
until her first arrival at the next port after the expiry of such period.
274. Where it appears to the Central Government that any non-mechanically
propelled vessel does not have valid certificates required under this Act, it may,
after giving a reasonable opportunity of being heard to the owner, master or
charterer, take appropriate action including suspension or cancellation of
registration of such vessel under this Act.
Withdrawal,
suspension or
cancellation of
certificate.
Production of
certificate.
Agreements in
respect of
fishing vessel.
Fishery data to
be furnished by
Indian fishing
vessels.
Vessel not to
proceed without
valid
certificates.
Power of Central
Government to
initiate action
against
non-mechanically
propelled vessels.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 91
Statement
relating to crew
of vessels to be
maintained.
Inquiry to
jettisoning of
cargo.
Detention of
vessel by proper
officer.
Detention of
unseaworthy
vessels.
275. (1) Every owner, master or tindal or skipper of a vessel shall maintain
or cause to be maintained a statement of the crew of the vessel containing the
following particulars with respect to each member thereof in such form as may be
prescribed, namely:—
(a) his name;
(b) the details of the agreement with him under section 271;
(c) the wages payable to him;
(d) the names and addresses of his next-of-kin;
(e) the date of commencement of his employment; and
(f) such other particulars as may be prescribed.
(2) Every change in the crew of the vessel shall be entered in the statement
under sub-section (1).
(3) A copy of such statement and of every change entered therein shall be
communicated as soon as possible to the shipping master.
276. (1) If any owner, master or tindal or skipper of a vessel in the course
of the voyage, has jettisoned or claims to have jettisoned the whole or any part of
the cargo of the vessel on account of abnormal weather conditions or for any other
reason, he shall immediately after arrival of the vessel at any port or place in India,
give notice of such jettisoning to the proper officer and such notice shall contain
full particulars of the cargo jettisoned and the circumstances under which such
jettisoning took place.
(2) Where the proper officer receives the notice under sub-section (1), he
shall forthwith report in writing to the Central Government and may proceed to
make an inquiry into the matter.
277. (1) Any vessel attempting to ply or proceed to sea without free board
markings or any vessel which is so loaded as to submerge such markings or
carrying persons in excess of the certified capacity may be detained by a proper
officer until the vessel complies with the requirements of this Act.
(2) Save as otherwise provided, for the purposes of this Part, a proper officer
may, at any reasonable time, go onboard a vessel and may inspect or audit the
vessel and any part thereof, the structure, equipment, fittings, arrangements,
materials, systems, scantlings, cargo, provisions, stores, her certificates and
certificates of the crew onboard:
Provided that the proper officer shall not unreasonably hinder the operation
of the vessel or unreasonably detain or delay her from proceeding on any voyage.
(3) The owner, agent, master or every officer of the vessel shall afford to the
proper officer all reasonable facilities for a survey or audit and provide all such
information in respect of the vessel and her structure, equipment, fittings,
arrangements, materials, scantlings, systems, cargo, provisions, stores, her
certificates, and certificates of the crew, as the proper officer may reasonably
require.
278. (1) If any vessel under this Part arrives in or proceeds from a port or
place in India in an unseaworthy condition or which is likely to pose a threat to
the security on Indian coasts or offshore installations, the vessel may be detained
until the owner, master or tindal or skipper takes all reasonable measures to ensure
the seaworthiness of the vessel.
(2) Nothing contained in sub-section (1) shall affect the liability of the person
in charge of the vessel in respect of such unseaworthiness or threat to the security on
Indian coasts or offshore installations under any other provisions of this Act.
92 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
279. (1) Notwithstanding anything contained in this Part, the Central
Government may, by order in writing and upon such conditions, if any, as it
may think fit to impose, exempt any vessel or tindal, skipper or member of
crew of such vessel or any class thereof, from any specified requirement
contained in or prescribed in pursuance of this Act or dispense with the
observance of any such requirement in the case of any vessel or tindal, skipper
or member of crew of such vessel or any class thereof, if it is satisfied that
the requirement is substantially complied with or that compliance with the
requirement is or ought to be dispensed with in the circumstances of the case.
(2) Where an exemption is granted under sub-section (1) subject to any
condition, a breach of any such condition shall, without prejudice to any other
remedy, be liable to penalty under this Act.
280. (1) The Central Government may make rules to carry out the
provisions of this Part.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters,
namely:—
(a) the manner of deciding whether a vessel falls under Part XIII
under sub-section (2) of section 263;
(b) the scale of manning and fittings, material, appliances and
apparatus to be carried onboard by vessel under sub-section (1) of
section 264;
(c) policy of insurance for all persons employed as members of the
crew under sub-section (2) of section 264;
(d) the conditions and restrictions for serving on an Indian fishing
vessel under sub-section (2) and number of persons for manning fishing
vessels and their qualifications and other requirements, under
sub-section (3), of section 265;
(e) the different grades of fishers, requirements and manner of
grant of certificate under sub-section (1) of section 266;
(f) other certificates with requirements and the manner of its grant
under sub-section (3), and the form, fee and validity of such certificates
under sub-section (4), of section 266;
(g) the criteria for approving training institute, training courses and
method of conduct of such training for the grant of certificate of competency
or certificate of proficiency under sub-section (2) of section 267;
(h) the form and manner and fee payable for conduct of
examination under sub-section (3) of section 268;
(i) the form and manner of agreement with fisher under clause (a)
of section 271;
(j) the certificates required to ply or proceed to sea by a vessel
under sub-section (1) of section 273;
(k) the manner of grant of certificate and the period of such
certificate under sub-section (2) of section 273;
(l) the form for maintaining a statement of the crew of the vessel
and other particulars under sub-section (1) of section 275;
(m) any other matter which is required to be or may be prescribed.
Power to
exempt.
Power to make
rules.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 93
Offences and
penalties.
PART XIV
PENALTIES AND PROCEDURES
281. (1) Any person who contravenes any provision of this Act or any rule
or notification made or issued thereunder or fails to comply with any provision
thereof which it was his duty to comply with, shall be liable to penalty or be guilty
of an offence under this Act and if in respect of any such contravention or offence
no penalty or punishment is specially provided, he shall be liable to penalty which
may extend to fifty thousand rupees.
(2) The contraventions mentioned in column (2) of the table below, shall be
liable to the extent of penalty mentioned in column (4) of the said table, with
reference to such contraventions, respectively.
Table
Serial
No.
Contravention
Section
Penalties
(1)
(2)
(3)
(4)
1. If the Indian charterer fails to
comply with the conditions
prescribed under section 16.
16
Penalty which may extend to two
lakh rupees.
2. If the owner of an Indian vessel
fails to register a vessel under
sub-section (1) of section 20.
20(1)
Penalty which may extend to fifty
thousand rupees.
3. If a person fails to deliver the
certificate of registration to the
Registrar or person entitled as
required under sub-section (2) of
section 22.
22(2)
Penalty which may extend to fifty
thousand rupees.
4. If any person transfers a registered
mortgage in contravention of
sub-section (1) of section 30.
30(1)
Penalty which may extend to one
lakh rupees.
5. If an owner fails to make an
application for re-registration of a
vessel or for registering an
alteration of a vessel under
section 33.
33
Penalty which may extend to fifty
thousand rupees and in addition, a
penalty which may extend to two
thousand rupees for every day during
which the contravention continues.
6. If any person fails to hoist the proper
national colours except those
declared under sub-section (2) of
section 37, onboard the Indian
vessel.
37(2)
Penalty which may extend to two
lakh rupees.
7. If any person conducts training
course
in
contravention
of
sub-section (2) of section 47.
47(2)
Penalty which may extend to
twenty lakh rupees.
8. If any person obstructs authorised
person to inspect any maritime
training
institute
under
sub-section (3) of section 47.
47(3)
Penalty which may extend to two
lakh rupees.
9. If the master of any vessel fails to
produce the certificates under
sub-section (1) of section 49.
49(1)
Penalty which may extend to fifty
thousand rupees and in addition, a
penalty which may extend to five
thousand rupees for everyday during
which the contravention continues.
94 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
10. If any person causes a vessel to
proceed to sea in contravention of
sub-section (3) of section 57.
57(3)
Penalty which may extend to two
lakh rupees.
11. If any person engages or employsa
person below the age of sixteen
years in contravention ofsection59.
59
Penalty which may extend to two
lakh rupees for every seafarer
engaged in the contravention.
12. If any person engages or carries to
seaany seafarer in contravention of
section 60.
60
Penalty which may extend to fifty
thousand rupees for every seafarer
engaged in the contravention.
13. If any person engages or carries to
sea a seafarer in contravention of
sub-section (1) of section 61.
61(1)
Penalty which may extend to two
lakh rupees, for every seafarer
engaged in the contravention.
14. If any person engages a seafarer in
contravention of sub-section (1) of
section 62.
62(1)
Penalty which may extend to three
lakh rupees for every seafarer.
15. If any person engages a seafarer in
contravention of clause (b) of
sub-section (2) of section 62.
62(2)(b) Penalty which may extend to two
lakh rupees, for every seafarer
engaged in the contravention.
16. If any person discriminates between
seafarers in contravention of clause (d)
of sub-section (2) of section 62.
62(2)(d) Penalty which may extend to two
lakh rupees for every seafarer.
17. If any ship owner, master or his
agent engages any person to serve
as seafarer in contravention of
sub-section (3) of section 62.
62(3)
Penalty which may extend to two
lakh rupees.
18. If any recruitment and placement
service
agency
contravene
clause (a) or clause (b) or clause (c)
or clause (d) of sub-section (6) of
section 62.
62(6)(a),
(b), (c)
and (d)
Penalty which may extend to
fifteen lakh rupees.
19. If any recruitment and placement
service
agency
contravene
clause
(e)
or clause (f)
of
sub-section (6) of section 62.
62(6)(e)
and (f)
Penalty which may extend to five
lakh rupees.
20. If any master or ship owner or
recruitment and placement service
agency fails to enter into a seafarer
employment
agreement
in
contravention of sub-section (1) of
section 63.
63(1)
Penalty which may extend to fifty
thousand rupees for every seafarer.
21. If a master or ship owner of an
Indian vessel fails to discharge a
seafarer
in
contravention
of
sub-section (2) of section 80.
80(2)
Penalty which may extend to one
lakh rupees.
22. If any master discharges a seafarer
before the expiration of the period
for which he was engaged or leaves
a seafarer behind in contravention
ofsub-section (5)of section 80.
80(5)
Penalty which may extend to fifty
thousand rupees.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 95
23. If a master fails to make an entry
in the official logbook with
respect to a seafarer who is left
behind or lost overboard or is
deceased, or fails to take charge
of his property or fails to
discharge
such
property
in
contravention of section 81.
81
Penalty which may extend to
three times the value of the
property not accounted for or if
such value is not ascertained, to
twenty thousand rupees.
24. If any master or ship owner, or
his agent or seafarer fails to
produce any logbooks, papers or
other
documents
in
any
proceedings before a shipping
master or fails to attend such
proceedings in contravention of
section 84.
84
Penalty which may extend to five
lakh rupees.
25. If any person commits a breach of
any term of an award which is
bindingonhim undersub-section (8)
of section 89.
89(8)
Penalty which may extend to two
lakh rupees.
26. If any seafarer or class of
seafarers or union of seafarers
goes or remain on strike in
contravention of clause (a) of
sub-section (14) of section 89.
89(14)(a) Penalty which may extend to fifty
thousand rupees.
27. If any ship owner alters the
conditions
of
service
or
discharges or punishes a seafarer
in contravention of clause (b) of
sub-section (14) of section 89.
89(14)(b) Penalty which may extend to fifty
thousand rupees.
28. If any person obstructs the
shipping master or surveyor,
seafarer welfare officer or
Indian ambassador or any other
authorised officer from entering
or inspecting a vessel under
sub-section (1) of section 93.
93(1)
Penalty which may extend to
fifty thousand rupees unless he
can prove that the obstruction
was
caused
without
his
knowledge or connivance.
29. If the master or owner of a vessel
fails to be in possession of the
certificates
specified
in
sub-section (2) or sub-section (3)
of section 93.
93(2),
(3)
Penalty which may extend to
fifty thousand rupees unless he
proves that the non-compliance
was
not
caused
by
his
inattention, neglect or wilful
default.
30. If a master without reasonable
cause fails to facilitate a seafarer to
make
a
complaint
under
section 95.
95
Penalty which may extend to fifty
thousand rupees.
31. If a person goes onboard a vessel
in contravention of section 96.
96
Penalty which may extend to fifty
thousand rupees.
32. If a seafarer deserts his vessel in
contravention of clause (a) of
sub-section (1) of section 98.
98(1)(a) He shall be liable to forfeit all or
any part of the property he leaves
onboard and of the wages he has
then earned and also if the
desertion takes place at any place
96 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
outside India, to forfeit all or any
part of the wages which he may
earn in any other vessel in which he
may be employed until his next
return to India, and to satisfy any
excess of wages paid by the master
or owner of the vessel from which
he deserts to any substitute
engaged in his place at a higher rate
of wages than the rate stipulated to
be paid to him.
33. If a seafarer neglects or refuses,
without reasonable cause, to join
the vessel or does not proceed to
sea in his vessel or is absent
without leave in contravention of
clause (b) of sub-section (1) of
section 98.
98(1)(b) He shall, if the contravention does
not amount to desertion, be liable
to forfeit out of his wages a sum not
exceeding two days’ pay and in
addition for every twenty-four
hours of absence either a sum not
exceeding six days’ pay or any
expenses properly incurred in
hiring a substitute.
34. If any seafarer quits the vessel
without leave under clause (a) of
sub-section (1) of section 99.
99(1)(a) Forfeiture out of his wages of a
sum not exceeding one month’s
pay.
35. If any seafarer fails to attend his
vessel
under
clause
(b)
of
sub-section (1) of section 99.
99(1)(b) Penalty which may extend to one
lakh rupees but nothing herein shall
take away or limit any other
remedy which any person would
otherwise have for breach of
contract or refund of money
advanced or otherwise.
36. If any seafarer wilfully disobeys
any
lawful
command
under
clause (c) of sub-section (1) of
section 99.
99(1)(c) Forfeiture out of his wages of a
sum not exceeding two days’ pay.
37. If any master fails to report
desertion and absence without
leave
in
contravention
of
section 102.
102
Penalty which may extend to one
lakh rupees.
38. If any person persuades or attempts
to persuade a seafarer to neglect or
refuse to join or proceed to the
vessel or deserts his vessel, in
contravention of clause (a) of
section 108.
108(a)
Penalty which may extend to two
lakh rupees.
39. If any person harbours or secretes a
seafarer who has wilfully neglected
or refused to join or has deserted his
vessel, in contravention of clause (b)
of section 108.
108(b)
Penalty which may extend to two
lakh rupees.
40. If any person secretes himself and
goes to sea in contravention of
section 109.
109
Penalty which may extend to two
lakh rupees.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 97
41. If a master fails to deliver
documents
relating
to
the
navigation of the vessel to his
successor in contravention
of
sub-section (1)of section 110.
110(1)
Penalty which may extend to fifty
thousand rupees.
42. If the owner or master of a vessel
fails to comply with provisions of
the
international
conventions,
treaties
or
agreements
in
contravention of sub-section (1) of
section 116.
116(1)
Penaltywhich may extend to fifteen
lakh rupees and the vessel may also
be detained.
43. If the master of a vessel fails to
report the particulars of an incident
in contravention of sub-section (1)
of section 117.
117(1)
Penalty which may extend to fifty
thousand rupees.
44. If the master of a vessel fails to
report the particulars of an incident
relating to the loss or likely loss
overboard of dangerous goods in
contravention of sub-section (2) of
section 117.
117(2)
Penalty which may extend to two
lakh rupees.
45. If any master or owner of an Indian
vessel fails to comply with its
communication requirements
in
contraventionof section 120.
120
Penalty which may extend to fifteen
lakh rupees and the vessel may also
be detained.
46. If any master or owner of a vessel
does not carry onboard the
information
required
by
section 121.
121
Penalty which may extend to one
lakh rupees.
47. If the master or owner of the vessel
causes a vessel to be loaded in
contravention of sub-section (1) of
section 122.
122(1)
Penalty which may extend to four
lakh rupees and to such additional
penalty not exceeding twenty-five
thousand rupees for every inch or
fraction of an inch by which the
appropriate load lines on each side
of the vessel are submerged or
would have been submerged if the
vessel had been in salt waters and
had no list, as the principal officer
thinks fit to impose, having regard
to the extent to which the earning
capacity of the vessel is or would
have been increased by reason of
the submersion.
48. If the owner, agent or master of a
vessel carries passengers without
certificates required under Part VI in
contravention of sub-section (1) of
section 123.
123(1)
Penalty which may extend to two
lakh rupees.
49. If the owner, agent or master of
a vessel carrying passengers
fails to make a statement about
the passengers onboard such
vessel
in
contravention
of
sub-section (3) of section 123.
123(3)
Penalty which may extend to
two lakh rupees.
98 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
50. If the master or owner of a vessel
causes a vessel to proceed to sea
without valid certificates in
contravention of section 124.
124
Penalty which may extend to
fifteen lakh rupees and the vessel
may also be detained.
51. If a person commits misconduct
specified in any of the clauses
under
sub-section
(1)
of
section 125.
125(1)
Penalty which may extend to
fifty thousand rupees.
52. If any person carries or attempts
to carry cargo without the
required
certificates
in
contravention of sub-section (1)
of section 126.
126(1)
Penalty which may extend to
five lakh rupees.
53. If any person carries or attempts
to carry passengers without the
required
certificates
in
contravention of sub-section (2)
of section 126.
126(2)
Penalty which may extend to
five lakh rupees.
54. If any person or master sends or
takes or attempts to send or take
to sea unseaworthy vessel in
contravention of sub-section (1)
or sub-section (2) of section 127.
127(1), (2) Penalty which may extend to
two lakh rupees and ten lakh
rupees
for
every
repeat
contravention and the vessel
may also be detained.
55. If the ship owner or master of a
vessel or seafarer fails to take all
reasonable means to ensure the
seaworthiness of a vessel in
contravention of sub-section (1)
of section 128.
128(1)
Penalty which may extend to
two lakh rupees and five lakh
rupees
for
every
repeat
contravention.
56. If any vessel, company or port
facility fails to comply with the
requirements for safety and
security
management
in
contravention of sub-section (1)
of section 129.
129(1)
Penalty which may extend to
twenty-five lakh rupees.
57. If any owner or master of an
Indian vessel causes polluting
substance to be discharged
anywhere into the sea or owner
or master of a foreign vessel
causes polluting substance to be
discharged within the coastal
waters
in
contravention
of
section 133, then—
133
(a)
where
such
discharge is of harmful
substances carried by sea in
packaged form;
133
Penalty which may extend to ten
lakh rupees and such security as
may be considered necessary for
securing any damages that may
arise in future;
(b)
where
such
discharge is of sewage;
133
penalty which may extend to five
lakh rupees and such security as
may be considered necessary for
securing any damages that may
arise in future;
(c)
where
the
discharge is of ballast water
and sediments;
133
penalty which may extend to five
lakh rupees and such security as
may be considered necessary for
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 99
securing any damages that may
arise in future;
(d)
where
the
discharge is of any other
polluting substances.
133
penalty which may extend to two
lakh rupees and such security as
may be considered necessary for
securing any damages that may
arise in future.
58. If the ship owner, master or any
other person permits any vessel or
port or platform or man-made
structures at sea to engage in
dumping in contravention of
sub-section (6) of section 133.
133(6)
Penalty which may extend to two
lakh rupees and such security as
may be considered necessary for
securing any damages that may
arise in future.
59. If any vessel proceeds to sea
without
valid
certificates
in
contravention of section 135.
135
Penalty which may extend to
fifteen lakh rupees and the vessel
may also be detained.
60. If the master of a vessel fails to
maintain books of records in
contravention of section 136.
136
Penalty which may extend to fifty
thousand rupees.
61. If any master or owner of a vessel
which
is
detained
under
sub-section (3) of section 137
causes such vessel to proceed to
sea
before
its
release
in
contravention of section 137.
137(3)
Penalty which may extend to one
lakh rupees.
62. If the master of a vessel fails to
report the particulars of an incident
in contravention of sub-section (1)
of section 138.
138(1)
Penalty which may extend to one
lakh and fifty thousand rupees.
63. If any port authority or officer fails
to comply with the directions
issued by the Central Government
under
sub-section
(2)
of
section 142.
142(2)
Penalty which may extend to ten
lakh rupees.
64. If a master or person in-charge of a
vessel fails to render assistance in
case of collision in contravention of
sub-section (1) of section 158.
158(1)
Penalty which may extend to five
lakh rupees.
65. If a master fails to enter a statement
in relation to a collision in the
official logbook in contravention
of section 159.
159
Penalty which may extend to fifty
thousand rupees.
66. If the master or ship owner or his
agent fails to transmit a report of
the accident or damage to the
Director-General or the nearest
principal officer in contravention
of section 160.
160
Penalty which may extend to one
lakh rupees.
67. If the owner or agent of any Indian
vessel fails, without reasonable
cause, to give notice of loss of
Indian
vessel
to
the
Director-General in contravention
of section 161.
161
Penalty which may extend to one
lakh rupees.
100 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
68. If any person fails to maintain
compulsory insurance or other
financial security for maritime
claims
in
contravention
of
section 172.
172
Penalty which may extend to
fifteen lakh rupees and the vessel
may also be detained.
69. If any master or ship owner does
not carry the certificate required
under
sub-section
(1)
or
sub-section (2) of section 190.
190(1),(2) Penalty which may extend to one
lakh rupees.
70. If any master or ship owner does
not carry the certificate required
under
sub-section
(1)
or
sub-section (2) of section 207.
207(1), (2) Penalty which may extend to
fifteen lakh rupees.
71. If any person refuses or wilfully
neglects to comply with a notice or
makes any false statement in
contravention of sub-section (4) of
section 217.
217(4)
Penalty which may extend to one
lakh rupees.
72. If the primary response party fails
to engage in maritime emergency
response under section 226.
226
Penalty which may extend to five
lakh rupees and the vessel may also
be detained.
73. If the owner or master of a vessel
fails to conclude contracts with
salvors under section 251.
251
Penalty which may extend to fifty
thousand rupees.
74. If a salvor fails to perform his
duties under sub-section (1) of
section 252.
252(1)
Penalty which may extend to fifty
thousand rupees.
75. If the owner or master of a vessel or
the owner of other property fails to
perform
his
duties
under
sub-section (2) of section 252.
252(2)
Penalty which may extend to fifty
thousand rupees.
76. If the owner of a vessel fails to
comply with the requirements for
safety, security and prevention of
pollution
and
insurance
in
contravention of section 264.
264
Penalty which may extend to one
lakh rupees and the vessel may also
be detained.
77. If any person fails to comply with
the manning requirements under
sub-section (2) of section 265.
265(2)
Penalty which may extend to one
lakh rupees and the vessel may also
be detained.
78. If the ship owner, master, tindal or
skipper of a vessel fails to produce
certificates of competency or
proficiency or any other certificate
in contravention of section 270.
270
Penalty which may extend to fifty
thousand rupees.
79. If the owner or his agent or skipper
of an Indian fishing vessel fails to
enter into an agreement in
contravention of clause (a) of
section 271.
271(a)
Penalty which may extend to fifty
thousand rupees.
80. If the ship owner or master permits
a vessel to ply or proceed to sea
without
certificates
in
contravention of sub-section (1) of
section 273.
273(1)
Penalty which may extend to one
lakh rupees.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 101
81. If the ship owneror master or tindal
or skipper of a vessel fails to
maintain or cause to be maintained
a
statement
of
crew
in
contravention of section 275.
275
Penalty which may extend to one
lakh rupees.
82. If theship owneror master or tindal
or skipper of a vessel fails to
provide notice of jettisoning of
cargo
in
contravention
of
section 276.
276
Penalty which may extend to fifty
thousand rupees.
83. If the ship owneror agent or master
or officer of a vessel fails to provide
all reasonable facilities to the
proper officer for a survey or audit
in contravention of sub-section (3)
of section 277.
277(3)
Penalty which may extend to one
lakh rupees.
84. If any person hinders or obstructs
any
officer
or
person
in
contravention of sub-section (2) of
section 296.
296(2)
Penalty which may extend to fifty
thousand rupees.
85. If any ship owner or master or
tindal or skipper or seafarer or port
or any person or authority breaches
any condition subject to which any
exemption
is
granted
under
sub-section (2) of section 300.
300(2)
Penalty which may extend to fifty
thousand rupees.
86. If any ship owner or his agent or
master or seafarer or tindal or
maritime training institute or
recruitment
placement
service
provider or port or any person or
body of persons fails to comply
with the directions given under
section 301.
301
Penalty which may extend to five
lakh rupees.
87. If any owner or master of a vessel
allows a vessel to fly with the flag
of a State in contravention of
sub-section (1) of section 304.
304(1)
Penalty which may extend to five
lakh rupees and the vessel may also
be detained.
88. If any person acts in contravention
of control measures invoked by the
principal
officer
under
sub-section (4) of section 307.
307(4)
Penalty which may extend to ten
lakh rupees.
89. If any port fails to discharge the
obligations under the conventions
in contravention of sub-section (1)
of section 310.
310(1)
Penalty which may extend to five
lakh rupees.
90. If any port authority or State
Maritime Board or any other
authority or agency fails to render
services or assistance or take
measures in respect of any
abandoned
vessel
under
sub-section (1) of section 311.
311(1)
Penalty which may extend to one
lakh rupees.
102 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
91. If the registered owner of an
Indian vessel fails to maintain
compulsory adequate insurance
coverage or such other financial
security in contravention of
section 314.
314
Penalty which may extend to
seventy lakh rupees.
92. If any vessel is detained under
the provisions of this Act for
which no penalty is provided.
General Penalty which may extend to
fifteen lakh rupees.
93. If any person in the case of any
declaration
made
in
the
presence of, or produced to,
Registrar under Part III or in
any document or other evidence
produced to such Registrar—
(i) wilfully makes or
assists
in
making
or
procures to be made, any
false statement concerning
the title to or ownership
of or the interest existing in
any vessel or any share in a
vessel; or
General Penalty which may extend to
two lakh rupees.
(ii) utters, produces
or makes use of any
declaration or document
containing any such false
statement knowing the
same to be false.
94. If any person,—
(a) forges or fraudulently
alters
any
certificate
of
discharge or a certificate as to
the work of a seafarer or a
continuous discharge certificate
or
a
copy
of
any
such
certificate; or
(b) fraudulently uses any
certificate of discharge or a
certificate as to the work of a
seafarer
or
a
continuous
discharge certificate or a copy
of any such certificate which is
forged or altered or does not
belong to him.
General Penalty which may extend to
two lakh rupees.
95. If any person wilfully destroys
or mutilates or renders illegible
any entry in an official logbook
or wilfully makes or procures
to be made or assists in making
a false or fraudulent entry in or
omission from an official
logbook.
General Penalty which may extend to
two lakh rupees.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 103
(3) The offences mentioned in column (2) of the table below, shall be
punishable to the extent mentioned in column (4) of the said table, with
reference to such offences, respectively.
Table
96. If the master or owner or
agent
of a
special
trade
passenger vessel, after having
obtained
any
of
the
certificates referred to in
Part VI, fraudulently does or
suffers to be done anything
whereby
the
certificate
becomes inapplicable to the
altered state of the vessel, or
special trade passengers or
other matters to which the
certificate relates.
General Penalty which may extend to
one lakh rupees for the first
contravention and five lakh
rupees for every subsequent
contravention.
Serial
No.
Offences
Section
to which
offence
is
referred
Imprisonment or fine or
both
(1)
(2)
(3)
(4)
1. If any person causes a vessel to
proceed to sea without a valid
in
certificate of registration
contravention of section 15.
15
Imprisonment
which may
extend to six months, or fine
which may extend to two lakh
rupees, or both.
2. If any person uses Indian national
colour
in
contravention
of
sub-section (4) of section 37.
37(4)
Imprisonment which may
extend to two years, or fine
which may extend to two lakh
rupees, or both.
3. If an owner or a master of an
Indian
vessel
knowingly
conceals the Indian character of
the vessel in contravention of
section 38.
38
Imprisonment which may
extend to two years, or fine
which may extend to two lakh
rupees, or both.
4. If any person goes to sea without
holding a certificate granted
under the Act.
General
Imprisonment which may
extend to six months, or fine
which may extend to two lakh
rupees, or both.
5. If any person causes a vessel or
sailing or fishing vessel to
proceed to sea without the
required certificated personnel.
General
Imprisonment which may
extend to six months, or fine
which may extend to two lakh
rupees, or both.
6. If any person carries on the
business of recruitment and
placement service agency in
contravention of clause (a) of
sub-section (2) of section 62.
62(2)(a)
Imprisonment which may
extend to one year, or fine
which may extend to five lakh
rupees, or both.
7. If any person demands or
receives any remuneration from
any seafarer or person in
contravention of clause (c) of
sub-section (2) of section 62.
62(2)(c)
Imprisonment which may
extend to three months, or
fine which may extend to
five lakh rupees, or both.
104 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
8. If any seafarer does or refuses
or omits to do anything in
contravention of section 97.
97
Imprisonment which may
extend to two years, or fine
which may extend to five
lakh rupees or both.
9. If any seafarer is guilty of an
offence specified in clause (d)
of sub-section (1) of section 99.
99(1)(d)
Imprisonment which may
extend to one month and also
for every twenty-four hours
of
continuance
of
such
disobedience
or
neglect,
forfeiture out of his wages of
a sum not exceeding six days’
pay or any expenses which
may have been properly
incurred in hiring a substitute.
10. If any seafarer is guilty of an
offence specified in clause (e)
of sub-section (1) of section 99.
99(1)(e)
Imprisonment which may
extend to three months, or
fine which may extend to fifty
thousand rupees or both.
11. If any seafarer is guilty of an
offence specified in clause (f) of
sub-section (1) of section 99.
99(1)(f)
Forfeiture out of his wages
of a sum equal to the loss
sustained
and
also
imprisonment which may
extend to three months.
12. If a seafarer on or before being
engaged
wilfully
and
fraudulently makes a false
statement of the name of his last
vessel or alleged last vessel or
wilfully and fraudulently makes
a false statement of his own
name.
General
Fine which may extend to
fifty thousand rupees.
13. If any owner or master of an
Indian vessel causes polluting
substance to be discharged
anywhere into the sea or owner
or master of a foreign vessel
causes polluting substance to be
discharged within the coastal
waters in
contravention of
section 133, then—
133
(a)
where
the
discharge is of oil and
oily
mixtures
from
vessels;
133
Fine which may extend to
twenty-five lakh rupees, or
imprisonment for a term
which may extend to one year,
or both, and such security as
may be considered necessary
for securing any damages that
may arise in future;
(b)
where
the
discharge is of noxious
liquid substances.
133
Fine which may extend to ten
lakh rupees, or imprisonment
for a term which may extend
to six months, or both, and
such security as may be
considered
necessary
for
securing any damages that
may arise in future.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 105
14. If the owner, agent, master,
charterer, operator, lessee or
licensee of the vessel fails to
comply with any notice issued
under sub-section (2) of section 138.
138(2)
Imprisonment
which
may
extend to six months, or fine
which may extend to five lakh
rupees, or both, and if the
offence is a continuing one,
the offender shall be liable to a
further fine which may extend
to fifty thousand rupees per
day for every day during
which the offence continues
after conviction.
15. If the owner of any Indian
vessel or any equipment fails to
comply with the directions of
the Central Government issued
under sub-section (1) of section 139.
139(1)
Imprisonment
which
may
extend to six months or fine
which may extend to five lakh
rupees, or both, and if the
offence is a continuing one,
the offender shall be liable to a
further fine which may extend
to fifty thousand rupees per
day for every day during
which the offence continues
after conviction.
16. If the owner, manager, operator,
company, pilot, harbour master,
master, or other person in charge
fails to give notice of a marine
casualty
to
the
officer
in
contravention of sub-section (2) of
section 231.
231(2)
Fine which may extend to
fifty thousand rupees and in
default of payment, simple
imprisonment which may
extend to three months.
17. If the master or owner or the
operator of an Indian vessel or
any ship other than an Indian
vessel fails to report a wreck in
contravention of sub-section (1)
or sub-section (2) of section 236.
236(1), (2) Fine which may extend to
fifty thousand rupees and
in default of payment,
imprisonment which may
extend to three months.
18. If the owner or operator of a
ship fails to immediately mark
or maintain the mark of the
wreck in contravention of
sub-section (1) of section 238.
238(1)
Fine which may extend to
two lakh rupees and in
default
of
payment,
imprisonment which may
extend to six months.
19. If the master permits a vessel
to proceed to sea before such
vessel
is
released
from
detention by any competent
authority in contravention of
sub-section (2) of section 290.
290(2)
Imprisonment which may
extend to six months, or
fine which may extend to
two lakh rupees, or both.
20. If the owner, master or agent
of the vessel takes to sea any
person authorised under this
Act to detain or survey the
vessel in contravention of
sub-section (3) of section 290.
290(3)
Imprisonment which may
extend to one year, or fine
which may extend to two
lakh rupees, or both.
21. If the master or owner or agent
permits a nuclear vessel to
proceed to any port or place in
contravention of sub-section (1) of
section 298.
298(1)
Imprisonment which may
extend to six months, or
fine which may extend to
ten lakh rupees, or both.
106 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
282. (1) The authority for imposing the penalty under sub-section (2) of
section 281 shall be the principal officer.
(2) Any person aggrieved by the order of the principal officer imposing
the penalty under sub-section (1) may within a period of thirty days from the
date of receipt of such order, prefer an appeal before the Director-General in
such form and manner as may be prescribed.
(3) The Director-General shall dispose of such appeal within a period of
thirty days from the date of receipt of the appeal.
(4) No such order shall be passed under this section unless the parties
have been given a reasonable opportunity of being heard.
(5) Any contravention of the provisions of this Act for which penalty has
been provided may be compounded for the first contravention by an officer
designated by the Central Government by notification in this behalf.
(6) Notwithstanding anything contained in this Act, if any penalty imposed
by the principal officer or the Director-General under this Part is not deposited,
the amount shall be recovered as an arrear of land revenue.
283. (1) Any person committing any offence under this Act or any rules
made thereunder may be tried for such offence in any place in which he may be
found or in any court which the Central Government may by notification, direct
in this behalf, or in any court in which he might be tried under any other law for
the time being in force.
(2) No court inferior to that of the Judicial Magistrate of the first class shall
try any offence under sub-section (3) of section 281.
284. Notwithstanding anything contained in section 23 of the Bharatiya
Nagarik Suraksha Sanhita, 2023, it shall be lawful for a Judicial Magistrate of the
first class to pass any sentence authorised by or under this Act on any person
convicted of an offence under this Act or any rules made thereunder.
285. The Central Government or the State Government may, by notification,
appoint a person who is in practice as an advocate for not less than seven years as
a Special Public Prosecutor for the purposes of any case or class of cases under
this Act.
286. The penalties to which a master or owner of a special trade passenger
vessel is liable under section 281 shall be enforced only on a report made by the
proper officer in this behalf.
Explanation.—For the purposes of this section, “special trade passenger
vessel” means a mechanically propelled vessel carrying more than thirty special
trade passengers.
287. (1) If the person committing an offence under this Act is a company,
every person who, at the time the offence was committed, was in charge of, and
was responsible to, the company for the conduct of its business, as well as the
company, shall be deemed to be guilty of the offence and shall be liable to be
proceeded against and punished accordingly:
22. If the master or owner or agent
fails to comply with the order
issued under sub-section (2) of
section 298.
298(2)
Imprisonment which may
extend to six months, or
fine which may extend to
ten lakh rupees, or both.
23. If any owner of a ship fails to
comply with directions of the
Director-General
under
sub-section (1) of section 302.
302(1)
Imprisonment which may
extend to six months, or
fine which may extend to
two lakh rupees, or both.
Authority for
imposition of
penalty and
procedure
therefor.
Place of trial
and jurisdiction
of court.
Special
provision
regarding
punishment.
Appointment of
Special Public
Prosecutors.
Penalties in
respect of
masters or
owners of
special trade
passenger
vessels.
Offences by
companies.
46 of 2023.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 107
Depositions to
be received in
evidence when
witness cannot
be produced.
Power to detain
foreign vessel
that has
occasioned
damage.
Provided that nothing in this sub-section shall render any such person liable
to any punishment provided in this Act, if he proves that the offence was
committed without his knowledge or that he exercised all due diligence to prevent
the commission of such offence.
(2) Notwithstanding anything contained in sub-section (1), where an offence
under this Act has been committed by a company, and it is proved that the offence
was committed with the consent or connivance of, or is attributable to any neglect
on the part of, any director, manager, secretary, or any other officer of the
company, such director, manager, secretary, or other officer shall also be deemed
to be guilty of that offence and shall be liable to be proceeded against and
punished accordingly.
Explanation.—For the purposes of this section,—
(a) “company” includes a co-operative society, a firm or other
association of individuals; and
(b) “director”, in relation to a firm, means a partner in the firm.
288. (1) Where, the testimony of any witness is required in relation to any
legal proceeding before any court or officer or authority under this Act, and the
defendant or the person accused does not produce the witness, then any deposition
previously made by the witness in relation to the same subject-matter before any
court in India or, if elsewhere, before any Indian ambassador, shall be admissible
in evidence—
(a) if the deposition is authenticated by the signature of the presiding
officer of such court or ambassador, before whom it is made;
(b) if the defendant or the person accused had an opportunity by
himself or his agent of cross-examining the witness;
(c) if the proceeding is criminal, on proof that the deposition was made
in the presence of the person accused.
(2) It shall not be necessary in any case to prove the signature or official
character of the person appearing to have signed such deposition, and a certificate
by such person that the defendant or person accused had an opportunity of
cross-examining the witness, and that the deposition, if made in a criminal
proceeding, was made in the presence of the person accused, shall, unless the
contrary is proved, be sufficient evidence that he had that opportunity and that it
was so made.
289. (1) Whenever any damage has in any part of the world been caused to
property belonging to the Government or to any citizen of India or a company by
a vessel other than an Indian vessel and that vessel is found within Indian
jurisdiction, such vessel shall be detained by an order of the High Court upon an
application alleging that the damage was caused by the misconduct or want of
skill of the master or any other seafarer of that vessel.
(2) The order of detention under sub-section (1) shall remain in force until
such time as the ship owner, master or consignee thereof has satisfied any claim
in respect of the damage or has given security to the satisfaction of the High Court
to pay all costs and damages that may be awarded.
(3) Whenever it appears that before an application can be made under this
section, the vessel will have departed from India or the territorial waters of India,
any proper officer may detain the vessel for such time as to allow the application
to be made and that officer shall not be liable for any cost or damages in respect
of the detention unless the same is proved to have been made without reasonable
grounds.
108 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(4) In any legal proceedings in relation to any damage referred to in
sub-section (1), the person giving security shall be made a defendant and shall
for the purposes of such proceeding be deemed to be the owner of the vessel
that has occasioned the damage.
290. (1) Where under this Act a vessel is authorised or ordered to be
detained, any commissioned officer of the Indian Navy or Indian Coast Guard or
any port officer, police, pilot, harbour master, conservator of port or customs
commissioner may detain the vessel under instructions of the proper officer.
(2) If any vessel after detention or after service on the master for any
notice of, or order for, such detention proceeds to sea before she is released
by any competent authority, the master of the vessel shall be guilty of an
offence under this Act.
(3) When a vessel so proceeding to sea takes to sea any person authorised
under this Act to detain or survey the vessel, the owner, master or agent of
such vessel shall each be liable to pay all expenses of, and incidental to, such
person being so taken to sea and shall also be guilty of an offence under this
Act.
(4) When any owner or master or agent is convicted of an offence under
sub-section (3), the court making the order of conviction may inquire and
determine the amount payable on account of expenses by such owner, master
or agent and may direct that the same shall be recovered from him in the
manner provided for the recovery of fines.
291. (1) When an order under this Act for the payment of any wages or
other sums of money is made by any court or other officer or authority and the
money is not paid at the time or in the manner directed, the sum mentioned in
the order with such further sum as may be thereby awarded for costs, may be
levied by distress and sale of the movable property of the person directed to
pay the same under a warrant to be issued for that purpose by such court.
(2) Where any court or other officer or authority has power under this
Act to make an order directing payment to be made of any seafarer’s wages,
fines or other sums of money, then, if the person so directed to pay the same
is the master, owner or agent of a vessel and the same is not paid at the time
or in the manner directed by such court or other officer or authority, the court
or officer or authority may, in addition to any other power which it may have
for the purpose of compelling payment by warrant, direct the amount
remaining unpaid to be levied by distress and sale of the vessel and her
equipment.
292. Where, for the purposes of this Act, any document is to be served
on any person, that document may be served—
(a) in any case by delivering a copy thereof personally to the person
to be served, or by leaving the same at his last place of residence, or by
post; and
(b) if the document is to be served on the master of a vessel, where
there is one, by leaving the same for him onboard that vessel, with the
person being or appearing to be in command or charge of the vessel;
and
(c) if the document is to be served on the master of a vessel where
there is no master and the vessel is in India, on the owner of the vessel,
or, if such owner is not in India, on some agent of the owner residing in
India, or, where no such agent is known or can be found, by affixing a
copy thereof on the vessel or at a suitable place on the bridge.
Power to
enforce
detention of
vessel.
Levy of wages,
etc., by distress
of movable
property or
vessel.
Service of
documents.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 109
Birth and death
of persons
onboard vessel
during a voyage.
Inquiry into
cause of death
onboard or
person missing
from Indian
vessel.
Certain persons
deemed to be
public servants.
Power of
persons
authorised to
investigate,
inquire, etc.
PART XV
MISCELLANEOUS
293. The master of any vessel performing a voyage shall, on arrival at the
next port or place of call, intimate the proper officer, the date of any birth or death
of any person occurring during the voyage and the cause of death or any other
relevant details, as the Central Government may by order, specify in this behalf.
294. (1) If any person dies onboard or is missing from an Indian vessel, the
master shall forthwith inform the Director-General and the proper officer of the
port or the next port of call.
(2) On receipt of information under sub-section (1), the proper officer shall
enquire into the cause of death and make an endorsement to that effect in the
official logbook, either that the statement of the cause of death in the book is in
his opinion true or the contrary according to the result of inquiry.
(3) If, in the course of any such inquiry, it appears to the proper officer that
death is caused onboard the vessel by violence or other improper means, he shall
either report the matter to the Director-General or, if the emergency of the case so
requires, shall take immediate steps for bringing the offender to trial.
295. The following persons shall be deemed to be public servants within the
meaning of clause (28) of section 2 of the Bharatiya Nyaya Sanhita, 2023,
namely:—
(a) every surveyor;
(b) every person appointed under this Act to report information as to
marine casualties under Part XI;
(c) every person authorised under this Act to make any investigation
or inquiry and all persons whom he calls to his aid;
(d) every person directed to make an investigation into an explosion
or fire on a vessel;
(e) every other officer or person appointed under this Act to perform
any functions thereunder.
296. (1) Every person who is empowered by this Act to make an
investigation or inquiry or to board, survey, inspect or detain a vessel,—
(a) may go onboard any vessel and inspect the same or any part
thereof, or any of the machinery, equipment or articles onboard thereof, or
any certificate of the master or other officer to which the provisions of this
Act or any of the rules made thereunder apply, not unnecessarily detaining
or delaying the vessel from proceeding on any voyage, and if in
consequence of any incident to the vessel or for any other reason it is
considered necessary so to do, may require the vessel to be taken into dock
for the purpose of inspection or survey;
(b) may enter and inspect any premises, the entry and inspection of
which appears to be requisite for the purpose of this section;
(c) may, by summons under his hand, require the attendance of all
such persons as he thinks fit to call before him and examine them for the
purpose of this section, and may require answers or returns to any enquiries
he thinks fit to make;
(d) may require and enforce the production of all relevant books,
papers, or documents;
(e) may administer oaths or may in lieu of requiring or administering
an oath, require every person examined by him to make and subscribe a
declaration of the truth of the statements made by him in his examination;
and
(f) may muster the crew of any such vessel.
45 of 2023.
110 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(2) No person shall hinder or obstruct any officer or person referred to in
sub-section (1) from going onboard any vessel or otherwise impede him in the
execution of his duties or the exercise of his powers under this Act.
297. Where this Act requires that the provisions or arrangements for a vessel shall
meet the obligations under the convention, or otherwise, the Central Government may,
after satisfying itself by trials or based on the convention or its protocol or its
amendments or otherwise, that any such provision or arrangement is as effective as that
so required, by order, direct or permit such other provisions or arrangements to be used
or provided.
298. (1) No nuclear vessel shall proceed to any port or place in India including
territorial waters thereof without permission of the Central Government.
Explanation.—For the purposes of this sub-section, “nuclear vessel” means a
vessel with a nuclear power plant.
(2) The Central Government may, by general or special order, issue such
directions, as it deems fit, to the registered owners of the vessels, for taking such security
measures as may be necessary.
299. The Central Government may, by notification, direct that the
provisions of this Act or any of them shall not apply to vessels belonging to the
Government of any State or to any class of such vessels.
300. (1) Notwithstanding anything contained in this Act, the Central
Government may, by order in writing and upon such conditions, if any, as it may
think fit to impose, exempt any vessel or tindal or skipper or seafarer or port or
any class of vessels, from any specified requirement contained in or prescribed in
pursuance of this Act or dispense with the observance of any such requirement in
the case of any such vessel or tindal or skipper or seafarer or port or any class of
vessels, if it is satisfied that the requirement is substantially complied with or that
compliance with the requirement is or ought to be dispensed with in the
circumstances of the case:
Provided that no exemption which is prohibited by the safety convention or
pollution prevention convention shall be granted under this sub-section.
(2) Where an exemption is granted under sub-section (1) subject to any
conditions, a breach of any of those conditions shall, without prejudice to any
other remedy, be deemed to be an offence under this section.
301. The Director-General may, if he is satisfied in the public interest or in
the interest of Indian shipping that it is necessary so to do, give by notice, circular,
order or guidelines in writing, such directions as he thinks fit to any vessel or
seafarer or tindal or ship owner or his agent or maritime training institute or
recruitment placement service provider or port or person or body of persons.
302. (1) The Director-General may by order in writing and upon such
conditions, if any, as he may think fit to impose, direct the ship owner who fails
to comply with the provisions of this Act, or rules made thereunder or is not taking
action for the safety and prevention of any harm to life, property or the
environment which may be caused by a vessel owned by such ship owner but not
abandoned by him, to take such measures as may be directed:
Provided that if the ship owner fails to comply with such directions, the
Director-General may take necessary action including confiscation or forfeiture
of the vessel or cargo, if any, or both, and dispose of the same as may be deemed
appropriate.
(2) The cost incurred by the Director-General in averting the harm
mentioned under sub-section (1) due to failure of timely action by the ship owner
shall be recovered from such ship owner as Government dues.
Power to permit
alternative
provisions and
arrangement.
Control of
nuclear vessels
and security
measures.
Exemption of
Government
vessels, foreign
and Indian.
Power to
exempt.
Power of
Director-General
to give
directions.
Special
provisions with
respect to
defaulting ship
owners.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 111
Right to pursue
foreign vessels
in high seas.
Power of
Central
Government
with
respect to vessel
without
nationality.
Protection of
action taken in
good faith.
Agreement with
other States.
Control
measures and
detention of
vessels.
(3) The Director-General shall be competent to adjust the cost referred to in
sub-section (2), with the funds generated by disposal of the vessel or the cargo, or
both.
303. The Central Government, if it has a reason to believe that any foreign
vessel has violated any law within the coastal waters, may authorise any vessel
under its control to pursue into the high seas such foreign vessel for investigations
and thereafter seize the vessel if considered necessary, for further proceedings:
Provided that as far as practicable, such foreign vessel shall be given a signal
to stop before pursuing the vessel into the high seas.
304. (1) Where it is established that a vessel within India or her coastal
waters is not legally entitled to fly the flag of a State or has lost such right, the
Central Government may take charge of such vessel and detain the same as a
vessel without nationality including its cargo, as may be deemed appropriate, in
such manner as may be prescribed.
(2) A vessel which sails under the flags of two or more States, using them
according to convenience, may be deemed to be a vessel without nationality.
305. No suit or other legal proceeding shall lie against any person for
anything which is in good faith done or intended to be done under this Act.
306. The Central Government may enter into agreement with other States
or organisations for effective implementation of the provisions of this Act.
307. (1) No vessel shall enter into or sail out of or operate within the port,
terminal, anchorages, port facilities, Indian offshore facilities or the territorial
waters of India, without complying with such requirements as to construction,
equipment, safety and security, cargo operations, pollution prevention, safe
manning, maritime labour standards, insurance, classification or such other
relevant requirements for the purposes of this Act as may be prescribed.
(2) The principal officer may order any unsafe vessel or vessel which
appears to him to be an unsafe vessel, to be provisionally detained for the purpose
of being surveyed.
(3) The surveyor may inspect the vessel referred to in sub-section (2) and if
it is found on such inspection that the vessel is an unsafe vessel or has failed to
comply with the provisions of this Act, report it to the principal officer.
(4) On receipt of report under sub-section (3), the principal officer may by
order, invoke such control measures as may be necessary, till such time the vessel
complies with the provisions of this Act or may allow such vessel to proceed to
sea on such conditions as deemed fit, if it does not pose a risk to safety of life
onboard or at sea, or an unreasonable threat of harm to the environment.
(5) Control measures under sub-section (4) may include—
(a) denial of entry into port;
(b) expanded inspection;
(c) delaying the vessel;
(d) stoppage of operations or restriction of operations including
movement within the port;
(e) requirement of any rectification of deficiencies within the specified
period;
(f) detention of vessel;
(g) expulsion of the vessel from port or place; or
(h) such other measures as may be prescribed.
112 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(6) The master or owner of the vessel may, within seven days from the
receipt of the order issued under sub-section (4), prefer an appeal before the
Director-General who may retain or modify the control measures or order release
of the vessel subject to such conditions as he may deem fit.
Explanation.—For the purposes of this section, “unsafe vessel” means a
vessel, including an unseaworthy vessel, which—
(a) poses a risk to safety of life; or
(b) poses an unreasonable threat of harm to environment by reason of
its safe manning, hull, machinery, equipment, training and working
conditions of seafarers or operational safety being substantially below the
required standards; or
(c) fails to comply with such other requirements as may be prescribed.
308. (1) When a vessel is detained under this Act, the owner of a vessel shall
be liable to pay to the Central Government the costs incidental to the detention
and survey of the vessel, as may be determined by the Director-General, and the
vessel shall not be released until such costs are paid and faults are rectified.
(2) The form and manner of determination of claims for costs of detention
under sub-section (1) and compensation or damages for detention of a vessel shall
be such as may be prescribed.
309. (1) On receipt of information from the Government of any State which
is a party to any convention under this Act, that any vessel other than an Indian
vessel within the territorial waters of India has contravened the provisions of such
convention, the Central Government may detain the vessel for such period and
subject to such conditions as may be deemed necessary.
(2) When a vessel other than an Indian vessel is detained under this Act, a
copy of the order for the provisional detention of the vessel shall forthwith be
served on the ambassador of the State to which the vessel belongs at or nearest to
the port in which such vessel is detained.
310. (1) The Director-General shall,—
(a) ensure that the obligations under the conventions are discharged
by the ports;
(b) supervise, monitor and ensure that such obligations are effectively
discharged by the ports.
(2) The Director-General may call for such information and pass such
directions as he may deem fit, for the discharge of obligations by the ports.
311. (1) The Central Government may give such directions in writing, as it
deems appropriate, to a port authority or State Maritime Board or any other
authority or agency to render services or assistance or take measures in respect of
any abandoned vessel which is abandoned on or near the coast of India or within
the coastal waters.
(2) The directions given under sub-section (1) shall be aimed at ensuring
safety, security, preventing the abandoned vessel from posing a threat to life or
property or environment, including protection of India’s coastline or related
interests from pollution or threat of pollution arising out of the abandoned vessel.
(3) Any costs or expenses incurred by the Central Government or any
authority or agency, for taking any measures in respect of an abandoned vessel
under sub-section (1), shall constitute a debt due to the Central Government and
may be recovered from the proceeds received from the sale of the vessel or its
cargo.
Costs of
detention and
damages.
Procedure for
detention of
vessel other than
Indian vessel.
Obligations of
ports under
conventions and
monitoring
thereof by
Director-General.
Power of
Central
Government in
respect of
abandoned
vessels.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 113
Power to cancel,
suspend, etc.,
certificate of
seafarers.
Re-hearing.
Maintenance of
insurance or
such other
financial
security.
Use and
maintenance of
electronic
records.
(4) The procedure for reimbursement of costs or expenses, including the
manner of determination of the rates for services rendered, to the authority or
agency complying with the directions of the Central Government under
sub-section (1), shall be such as may be prescribed.
(5) Notwithstanding anything contained in the Admiralty (Jurisdiction and
Settlement of Maritime Claims) Act, 2017, the debt due to the Central Government
under sub-section (3), shall be a charge on the vessel and shall have first priority
after the following maritime liens—
(a) claims for wages and other sums due to the master, officers and
other members of the vessel’s complement in respect of their employment
on the vessel, including costs of repatriation and social insurance
contributions payable on their behalf;
(b) claims in respect of loss of life or personal injury occurring,
whether on land or on water, in direct connection with the operation of the vessel.
312. The Central Government may, by order, cancel or suspend any
certificate granted under this Act to any seafarer for any specified period,—
(a) if an inquiry report or investigation report reveals that the seafarer
is incompetent or is guilty of misconduct; or
(b) in a case of collision, where the seafarer has failed to render
assistance; or
(c) if the seafarer has been convicted of any offence under this Act or
any non-bailable offence has been committed by such seafarer under any
other law for the time being in force in India or outside India; or
(d) if any casualty has been caused by wrongful act or default of the
seafarer; or
(e) if the seafarer to whom the certificate has been granted contravenes
any provisions of this Act:
Provided that no order under this section shall be passed unless the person
concerned has been given an opportunity of being heard.
313. Whenever an investigation or inquiry is made under this Act, the
Central Government may order the case to be re-heard either generally or as to
any part thereof, and shall so order, if—
(a) new and important evidence which could not be produced at the
time of investigation is discovered; or
(b) for any other reason, there is in its opinion, a miscarriage of justice.
314. Without prejudice to the insurance or other financial security required
to be maintained under Chapters II, III and IV of Part IX, Part X and Chapter I
of Part XII, every registered owner of an Indian vessel shall, for the purpose of
covering his liability under this Act, be required to compulsorily maintain
adequate insurance coverage or such other financial security as may be
prescribed.
315. (1) Where any provision of this Act or the rules made thereunder
provide for—
(a) the filing of any form, application or any other document with any
office, authority, body or agency owned or controlled by the Government in
a particular manner;
(b) the issue or grant of any certificate, licence, permit, sanction,
approval or endorsement, by whatever name called, in a particular manner; or
22 of 2017.
114 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
(c) the receipt or payment of money in a particular manner,
then notwithstanding anything contained in such provision, such requirement shall be
deemed to have been satisfied if such filing, issue, grant, receipt or payment is effected
by means of such electronic form.
(2) The Central Government shall, for the purpose of sub-section (1),
prescribe—
(a) the manner and form in which such electronic forms and documents
shall be filed, created or issued; and
(b) the manner or method of payment of any fee or charges for filing,
creation or issue of any electronic document under clause (a).
(3) Any agreement, record, database, logbooks, record books and such other
documents required to be stored, maintained or updated by the Central Government
or the Director-General or by any other person under this Act or the rules made
thereunder, may be maintained in electronic form.
316. The Central Government, based on activities performed or services
provided by vessels, may by general or special order, classify the vessels into different
categories.
317. (1) The Central Government, in such circumstances as it may, by
notification, specify in this behalf, require every service provider or agent in
respect of any Indian vessel or other vessel operating in coastal waters in relation
to import, export or domestic transportation, to specify in the Bill of Lading or
any other transport document, all charges to be paid by an exporter, importer,
consignor or consignee in India, subject to the terms and conditions for the
specification of such charges and the issuance of the Bill of Lading or any other
transport document, as may be specified in that notification:
Provided that the charges to be paid by such exporter, importer, consignor
or consignee shall include both fixed and conditional charges:
Provided further that no service provider or agent shall levy any charges other
than charges specified by him in the Bill of Lading or any other transport document.
(2) If the service provider or agent fails to specify the charges under
sub-section (1) or levies any charges other than the charges specified by him in
the Bill of Lading or any other transport document, he shall be liable to penalty
which may extend to five lakh rupees.
(3) The authority for imposing the penalty under sub-section (2) shall be such
officer as the Central Government may, by notification, specify in this behalf.
(4) Any person aggrieved by the order of imposition of penalty under this
section may prefer an appeal in accordance with such procedure as may be
prescribed, before such officer as the Central Government may, by notification,
specify:
Provided that no order under this section shall be passed without giving
the person a reasonable opportunity of being heard.
318. The Director-General shall have the power to call for such
information as may be required to ensure compliance with the provisions of this
Act.
319.(1) Without prejudice to any other power to make rules contained
elsewhere in this Act, the Central Government may make rules generally to
carry out the provisions of this Act.
(2) In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
Classification of
vessels.
Transparency of
charges.
Power of
Director-General
to call for
information.
General power
to make rules.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 115
Provisions with
respect to rules.
Power to
remove
difficulties.
(a) the salary, allowances and other terms and conditions of service of
the officers under sub-section (2) of section 8;
(b) the powers and functions of the senior radio surveyors and radio
inspectors under sub-section (2) of section 10;
(c) regulatory and oversight functions of the body under sub-section (3)
of section 13;
(d) other functions of the body under clause (d) of sub-section (4) of
section 13;
(e) the form and manner in which a person aggrieved may prefer an
appeal before the Director-General under sub-section (2) of section 282;
(f) the manner of detention of vessel under sub-section (1) of section 304;
(g) other relevant requirements under sub-section (1) of section 307;
(h) such other measures which shall constitute control measures under
clause (h) of sub-section (5) of section 307;
(i) such other requirements under the Explanation to section 307;
(j) the form and manner of determination of claims and compensation
or damages for detention of a vessel under sub-section (2) of section 308;
(k) the procedure for reimbursement of costs or expenses, including
the manner of determination of the rates for services rendered to the
authority or agency under sub-section (4) of section 311;
(l) insurance coverage or other financial security to be maintained by
registered owner of an Indian vessel under section 314;
(m) the manner and form of filing, creating or issuing electronic forms
and documents and the manner or method of payment of fee or charges for such
filing, creating or issuing under clause (a) and clause (b) of sub-section (2) of
section 315;
(n) procedure for preferring an appeal under sub-section (4) of section 317;
(o) the form and manner of informing the Central Government of any
requirement or prohibition imposed or threatened to be imposed pursuant to the
measures taken by any other country under sub-section (2) of section 323; and
(p) any other matter which is required to be or may be prescribed.
320. (1) All rules made under this Act shall be published in the Official
Gazette.
(2) In making a rule under this Act, the Central Government may direct that a
breach thereof shall be liable to penalty which may extend to fifty thousand rupees,
and if the breach is a continuing one, with further penalty which may extend to five
thousand rupees for every day after the first day during which the breach continues.
(3) Every rule made under this Act shall be laid, as soon as may be after it
is made, before each House of Parliament, while it is in session, for a total period
of thirty days which may be comprised in one session or in two or more successive
sessions, and if, before the expiry of the session immediately following the session
or the successive sessions aforesaid, both Houses agree in making any
modification in the rule or both Houses agree that the rule should not be made,
the rule shall, thereafter, have effect only in such modified form or be of no effect,
as the case may be; so, however, that any such modification or annulment shall
be without prejudice to the validity of anything previously done under that rule.
321. (1) If any difficulty arises in giving effect to the provisions of this Act,
the Central Government may, by order, published in the Official Gazette, make
such provisions not inconsistent with the provisions of this Act, as appear to it to
be necessary, for removing the difficulty:
Provided that no such order shall be made under this section after the expiry
of a period of three years from the date of commencement of this Act.
116 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-25
44 of 1958.
19 of 1838.
(2) Every order made under this section shall be laid, as soon as may be after
it is made, before each House of Parliament.
322. (1) The Central Government may, if it thinks fit, constitute one or more
committees consisting of such number of persons as it may appoint thereto,
representing the interests principally affected or having special knowledge of the
subject-matter, for the purpose of advising it when considering the making or
alteration of any rules or scales of fees under this Act or for any other purpose
connected with this Act.
(2) There shall be paid to the members of any such committee such
travelling and other allowances as the Central Government may fix.
(3) The committees may be constituted under this section to advise the
Central Government either generally as regards any rules or scales of fees or as
regards any class or classes of rules or scales of fees in particular or for any other
purpose connected with this Act.
323.(1) The Central Government may, by order in writing, specify that the
provisions of this section shall apply to measures taken by any other country for
regulating the terms and conditions upon which goods or passengers may be
carried by sea, which constitute an infringment of the jurisdiction of India, in so
far as they apply to—
(a) things done or to be done outside the territorial jurisdiction of that
country; and
(b) persons carrying on lawful business in India.
(2) Where an order issued under sub-section (1) is in force, every person who
is subject to such measures taken by another country shall inform the Central
Government of any requirement or prohibition imposed or threatened to be imposed
on him pursuant to such measures in such form and manner as may be prescribed.
Explanation.—For the purposes of this sub-section, “requirement” includes
any requirement to submit any contract or other document for approval thereunder.
(3) Where any information under sub-section (2) is received from any person,
or there are grounds to believe that such information is likely to be received, the
Central Government may, by an order in writing, give to such person directions
prohibiting compliance with any such measure as it considers necessary.
(4) The Central Government may, by an order in writing, prohibit or restrict
any person from complying with the requirement to produce any commercial
document or information compiled from commercial documents, to a court of
another country, if it appears to the Central Government that such document is
not within the territorial jurisdiction of that country, and constitutes or may
constitute an infringement of the jurisdiction of India.
324. (1) The Merchant Shipping Act, 1958 (except Part XIV but not including
section 411A therein) and the Coasting Vessels Act, 1838 is hereby repealed.
(2) Notwithstanding such repeal,—
(a) any rule, regulation, bye-law, order, notification or exemption
made, issued or granted under any enactment hereby repealed shall, until
revoked, have effect as if it had been made, issued or granted under the
provisions of this Act;
(b) any office established or created, officer or person appointed and
anybody elected or constituted under any enactment hereby repealed shall
continue and shall be deemed to have been established, created, appointed,
elected, or constituted under this Act;
(c) any document referring to any enactment hereby repealed shall be
construed as referring to this Act or to the provision of this Act;
(d) any fine levied under any enactment hereby repealed may be
recovered as if it had been levied under this Act;
Power to
constitute
committees.
Power of
Central
Government to
protect interest
of Indian
Shipping.
Repeals and
savings.
No. 11-25] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3 117
Amendment of
Act 20 of 2021.
Power of
Director-General
appointed under
Merchant
Shipping Act,
2025 to issue
directions.
(e) any offence committed under any enactment hereby repealed may
be prosecuted and punished as if it had been committed under this Act;
(f) any vessel registered under the enactments hereby repealed shall be
deemed to have been registered under this Act;
(g) any mortgage of vessels recorded in any register book maintained
at any port in India under any enactment hereby repealed shall be deemed
to have been recorded in the register book under the corresponding
provision of this Act;
(h) any licence, certificate of competency or service, certificate of
survey, A or B certificate, safety certificate, qualified safety certificate,
safety equipment certificate, exemption certificate, international or Indian
load line certificate or any other certificate or document issued, made or
granted under any enactment hereby repealed and in force at the
commencement of this Act, shall be deemed to have been issued, made or
granted under this Act and shall, unless cancelled under this Act, continue
in force until the date shown in the certificate or document;
(i) any proceeding pending before any court under any enactment
hereby repealed may be tried or disposed of under the corresponding
provisions of this Act;
(j) any inspection, investigation or inquiry ordered to be done under
the provisions of any enactment hereby repealed shall continue to be
proceeded with as if such inspection, investigation or inquiry is ordered to
be done under the corresponding provisions of this Act.
(3) The mention of particular matters in this section shall not be held to
prejudice or affect the general application of section 6 of the General Clauses
Act, 1897, with regard to the effect of repeals.
PART XVI
AMENDMENT TO THE MARINE AIDS TO NAVIGATION ACT, 2021
325. In the Marine Aids to Navigation Act, 2021, after section 48, the
following section shall be inserted, namely:—
“48A. The Director-General appointed under the Merchant Shipping
Act, 2025 may issue such directions as may be necessary, to
the Director General appointed under this Act for the purposes
of implementation of this Act.”.
DR. RAJIV MANI,
Secretary to the Govt. of India.
10 of 1897.
118
The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948.
[No. 11-25
Sd/-
MINISTRY OF LAW AND JUSTICE
/HJLVODWLYH'HSDUWPHQW
New Delhi, the 21st December, 2025/Agrahayana 30, 1947 (Saka)
The following Act of Parliament received the assent of the President on the
20th December, 2025 and is hereby published for general information:—
THE VIKSIT BHARAT—GUARANTEE FOR ROZGAR AND
AJEEVIKA MISSION (GRAMIN): VB—G RAM G (fodflr
Hkkjr—th jke th) ACT, 2025
1ඈඈൿ
[20th December,@
An Act to establish a rural development framework aligned with the
national vision of Viksit Bharat @2047, by providing a statutory
JXDUDQWHHRIRQHKXQGUHGDQGWZHQW\¿YHGD\VRIZDJHHPSOR\PHQW
LQ HYHU\ ¿QDQFLDO \HDU WR HYHU\ UXUDO KRXVHKROG ZKRVH DGXOW
members volunteer to undertake unskilled manual work; to promote
empowerment, growth, convergence and saturation for a prosperous
and resilient rural Bharat; and for matters connected therewith or
LQFLGHQWDOWKHUHWR
WHEREAS to align the rural development framework with the national vision
of Viksit Bharat @2047 by providing an enhanced statutory wageemployment
guarantee of one hundred and twenty-five days in each financial year to such rural
households whose adult members volunteer to undertake unskilled manual
work, thereby enabling them to participate more effectively in the expanded
livelihood security framework;
EXTRAORDINARY
REGD NO. JK–33
———————————————————————————————
Vol. 139
Srinagar, Thu., the 11th June, 2026/21st Jyai., 1948. [No. 11-37
———————————————————————————————
PART IV
Reprints from the Government of India Gazette.
———
Short title and
FRPPHQFHPHQW
'HILQLWLRQV
AND
WHEREAS to focus on empowerment, growth, convergence and
saturation through public works aggregating into forming Viksit Bharat
National Rural Infrastructure Stack, with a thematic focus on water security
through water-related works, core rural infrastructure, livelihood-related
infrastructure and special works to mitigate extreme weather events;
AND WHEREAS to facilitate adequate farm-labour availability during peak
agricultural seasons, and, in view of the wageemployment guarantee for the rural
workforce;
AND WHEREAS to institutionalise convergence, saturation-driven planning and
whole of government delivery through Viksit Gram Panchayat Plans, integrated
with the PM Gati Shakti to address the varying needs of Gram Panchayats, and
powered by geospatial systems, digital public infrastructure, District and State
planning mechanisms, with such plans aggregated at the Block, District, State and
National levels;
AND
WHEREAS
to
modernise governance, accountability and citizen
engagement through a comprehensive digital ecosystem, including biometric
authentication at various levels, global positioning system or mobile based
worksite monitoring, real-time management information system dashboards,
proactive public disclosures, and use of Artificial Intelligence for planning,
DXGLWVDQGIUDXGULVNPLWLJDWLRQ
BE it enacted by Parliament in the Seventy-sixth Year of the Republic of India
as follows:—
CHAPTER I
PRELIMINARY
1 () This Act may be called the Viksit Bharat—Guarantee for Rozgar and
Ajeevika Mission (Gramin) VB—G RAM G (ĮęøĮĝć Đĭēć—ÿı ēĭđ ÿı) $FW
() It shall come into force on such date as the Central Government may, by
notification, appoint:
Provided that the different dates may be appointed for different States or for
different areas in a State and any reference in any such provision to the
commencement of this Act shall be construed as a reference to the coming into
IRUFHRIWKDWSURYLVLRQLQVXFK6WDWHRUDVWKHFDVHPD\EHLQVXFKDUHD
2 In this Act, unless the context otherwise requires,—
(D) “adult” means a person who has completed the eighteenth year
of age;
(E) “applicant” means the head of a household or any of its other adult
members who has applied for employment under the Scheme;
(F) “Block” means a community development area within a district
comprising a group of Gram Panchayats;
(G) “Central Council” means the Central GramLn Rozgar Guarantee
Council constituted under section 12;
(H) “Centrally Sponsored Scheme” means a scheme in which the
Central Government provides full or partial financial assistance and
the State Governments undertake its implementation;
(I) “District Programme Coordinator” means an officer of the State
Government designated as such officer under sub-section () of section 17
for the implementation of the Scheme in a district;
2 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
(J) “household” means the members of a family related to each other by
blood, marriage or adoption and normally residing together and sharing meals
or holding a common ration card;
(K) “implementing agency” includes any department of the Central
Government or a State Government, a Zila Parishad, Panchayat at
intermediate level, Gram Panchayat or any local authority or the Government
undertaking, to undertake the implementation of any work taken up under
the Scheme;
(L) “intermediate level” means a level between the village and district
levels as specified under clause (F) of Drticle 243 to the Constitution of India;
(M)“National Level Steering Committee” means a steering committee
constituted by the Central Government under sub-section () of section 14;
(N) “normative allocation” means the allocation of the fund made by the
Central Government to the State;
(O) “notification” means a notification published in the Official Gazette
and the term “notify” or ³notified´, shall be construed accordingly;
P “prescribed” means prescribed by rules made under this Act;
Q “Programme Officer” means an officer appointedXQGHUVXEVHFWLRQ
of section18;
(R) “rural area” means any area in a State except those areas covered by
any urban local body or a Cantonment Board established or constituted under
any law for the time being in force;
(S) “Schedule” means Schedules appended to this Act;
(T) “Scheme” means the Scheme notified by the State Government under
sub-section () of section ;
(U) “State” means a State specified in the First Schedule to the
Constitution and includes a Union territory;
(V) “State Council” means the State Gramin Rozgar Guarantee Council
constituted under sub-section () of section 13;
(W) “State Level Steering Committee” means a steering committee
constituted under sub-section () of section 15;
(X) “unskilled manual work” means any physical work which any adult
person is capable of doing without any skill or special training;
(Y) “Viksit Bharat National Rural Infrastructure Stack” means the
consolidated aggregation comprising proposed works emerging from the
Viksit Gram Panchayat Plans aggregated at the District and State
levels, and aligned with the four thematic domains of works specified
in Schedule I;
(Z) “Viksit Gram Panchayat Plan” means a future-ready, convergence-
based local development plan aligned with the vision of Viksit Bharat @2047,
formulated by the Gram Panchayat through a participatory and evidence-based
process, and serving as the basis for identification and prioritisation of works
under this Act, as provided in sub-section () of section 4;
([) “wage rate” means the wage rate referred to in section 10;
(\) “work” means any work undertaken or executed under the Scheme.
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3
State
Government
implementation
framework for
6FKHPH
Planning
framework in
alignment with
vision of Viksit
%KDUDW#
Guarantee of
wage
employment to
UXUDOKRXVHKROGV
CHAPTER II
IMPLEMENTATION FRAMEWORK
3 ) The State Government, shall within six months from the date of
commencement of this Act, by notification, make a Scheme consistent with the
SURYLVLRQVRIWKLV$FWDQGWKHIHDWXUHVSURYLGHGWKHUHLQ
() The Scheme made under sub-section () shall be implemented as a
Centrally Sponsored Scheme, under which the financial liability shall be shared
between the Central Government and the State Government in accordance with the
fundsharing pattern provided under sub-section () of section 22 of this Act,
including enhanced share of the Central Government in respect of the North-Eastern
States and Himalayan States, and the responsibility of the State Government to bear
DQ\H[SHQGLWXUHLQFXUUHGLQH[FHVVRILWVDOORFDWHGVKDUH
4() All works undertaken under this Act shall be originated from the Viksit
Gram Panchayat Plans prepared under sub-section (), and consolidated at the
Block, District and State levels and further aggregated into the Viksit Bharat
National Rural Infrastructure Stack, which shall comprise a comprehensive listing
RIZRUNVDOLJQHGZLWK1DWLRQDOGHYHORSPHQWSULRULWLHV
()The Viksit Bharat National Rural Infrastructure Stack shall encompass
four thematic focus domains, namely:—
(D) water security through water-related works;
(E) core rural infrastructure;
(F) livelihood-related infrastructure; and
(G ZRUNVIRUWKHPLWLJDWLRQRIH[WUHPHZHDWKHUHYHQWV
() Rural works planning under this Act shall be undertaken through Viksit
Gram Panchayat Plans, prepared by the Gram Panchayats and integrated with the
PM Gati Shakti National Master Plan, so as to enable spatially optimised
infrastructure development and strengthened inter-departmental convergence in
DFFRUGDQFHZLWKWKHSURYLVLRQVVSHFLILHGLQ6FKHGXOH,
() For the purposes of sub-section (), Gram Panchayats shall be categorised
into Category A, Category B and Category C, in accordance with the provisions
VSHFLILHGLQ6FKHGXOH,
() The Central Government shall determine the State-wise normative
allocation for each financial year, based on objective parameters as may be
SUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
() Any expenditure incurred by a State in excess of its normative allocation
shall be borne by the State Government in such manner and by such procedure as
may be prescribed by WKH&HQWUDO*RYHUQPHQW
5 ) Save as otherwise provided, the State Government shall, in such rural
area in the State as may be notified by the Central Government, provide to every
household whose adult members volunteer to do unskilled manual work, not less
than one hundred and twenty-five days of guaranteed employment in a financial
\HDULQDFFRUGDQFHZLWKWKH6FKHPHPDGHXQGHUWKLV$FW
() Every person who has done the work given to him under the Scheme shall
be entitled to receive wages at the wage raWHIRUHDFKGD\RIZRUN
() Save as otherwise provided in this Act, the disbursement of daily wages
shall be made on a weekly basis or in any case not later than a fortnight after the
GDWHRQZKLFKVXFKZRUNZDVGRQH
4 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
() The Central Government or the State Government, may within the limits
of economic capacity and development, make provisions for securing work to every
adult member of a household under the Scheme for any period beyond the period
guaranteed under sub-section (DVPD\EHH[SHGLHQW
6 ) Notwithstanding anything contained in this Act or rules made
thereunder, and to facilitate adequate availability of agricultural labour during peak
agricultural seasons, no work shall be commenced or executed under this Act,
during such peak seasons as may be notified under sub-section (
() The State Governments shall notify in advance, a period aggregating to
sixty days in a financial year, covering the peak agricultural seasons of sowing and
KDUYHVWLQJGXULQJZKLFKZRUNVXQGHUWKLV$FWVKDOOQRWEHXQGHUWDNHQ
() The State Government may issue distinct notifications for different areas
of the State, including districts, blocks or Gram Panchayats, based on agro-climatic
zones, local patterns of agricultural activities or other relevant factors, and every
such notification shall have a binding effHFWIRUWKHSXUSRVHVRIWKLV$FW
() All authorities responsible for planning, sanctioning or executing works
under this Act shall ensure that all works are undertaken only outside the notified
SHDNDJULFXOWXUDOVHDVRQV
7 ) Notwithstanding anything contained in this Act, the State Government
may recommend to the Central Government, the need for special operational
relaxations during natural calamities or other extraordinary circumstances for the
purpose of ensuring timely resSRQVHDQGVXSSRUWWRDIIHFWHGKRXVHKROGV
() The Central Government may, upon consideration of the recommendations
received from the State Government, make specific relaxations, including temporary
expansion of permissible works, relaxed documentation norms, or enhanced wage
HPSOR\PHQWSURYLVLRQLQJDVPD\EHDSSURSULDWHWRDGGUHVVWKHVLWXDWLRQ
() Notwithstanding anything in sub-section (), the Central Government may
GHFODUHVXFKUHOD[DWLRQVDVPD\EHDSSURSULDWHWRDGGUHVVWKHVLWXDWLRQ
CHAPTER III
Viksit Bharat—Guarantee for Rozgar and Ajeevika Mission (Gramin):
VB—G RAM G (ĮęøĮĝć Đĭēć—ÿı ēĭđ ÿı) Scheme
8 ) For the purposes of giving effect to the provisions of section 3, every
State Government shall, make a Scheme, for providing a guarantee of one hundred
and twenty-five days of wage employment in a financial year to every rural
household in the rural areas covered under the Scheme and whose adult members,
by application, volunteer to do unskilled manual work subject to the conditions
XQGHUWKLV$FW
() The State Government shall publish a summary of the Scheme made under
sub-section () in at least two local newspapers, one of which shall be in a vernacular
language circulating in the area or areas to which the Scheme applies, and shall also
make such summary publicly available through electronic means, including the
RIILFLDOZHEVLWHRIWKH6WDWH*RYHUQPHQWRUDQ\GHVLJQDWHGGLJLWDOSODWIRUP
() The Scheme made under sub-section () shall conform to and provide for
the PLQLPXPIHDWXUHVVSHFLILHGLQ6FKHGXOH,
9 ) The State Government may, without prejudice to the conditions
specified in Schedule II, specify in the Scheme the conditions for providing
JXDUDQWHHGHPSOR\PHQWXQGHUWKLV$FW
() The persons employed under the Scheme made under this Act, shall be
entitled to such facilities not less than the minimum facilities specified in
6FKHGXOH,,
Facilitating
adequate
agricultural
labour
availability
during peak
agricultural
VHDVRQV
Relaxations
during natural
calamities and
extraordinary
FLUFXPVWDQFHV
Viksit Bharat—
Guarantee for
Rozgar and
Ajeevika
Mission
(Gramin):
VB—G RAM G
(ĮęøĮĝć
Đĭēć—ÿı ēĭđ
ÿı) Scheme
Conditions for
providing
guaranteed
HPSOR\PHQW
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 5
:DJHUDWH
Payment of
unemployment
DOORZDQFH
10 7KH&HQWUDO*RYHUQPHQWPD\E\QRWLILFDWLRQVSHFLI\WKHZDJHUDWHIRU
the purposes of this Act, which shall apply to all unskilled manual work provided
under the Scheme:
Provided that different wage rates may be notified by the Central Government
for different areas:
Provided further that the wage rate so notified shall not be less than the
SUHYDLOLQJZDJHUDWHDVQRWLILHGXQGHUVHFWLRQRIWKH0DKDWPD*andhi National
Rural Employment Guarantee Act, 2005:
Provided also that until a wage rate is notified by the Central Government
XQGHUWKLVVHFWLRQWKHZDJHUDWHVQRWLILHGXQGHUVHFWLRQRIWKH0DKDWPD*DQGKL
National Rural Employment Guarantee Act, 2005, shall continue to apply in the
DUHDVFRYHUHGE\WKLV$FW
11 ) If an applicant for employment under the Scheme is not provided such
employment within fifteen days of receipt of his application seeking employment or
from the date on which the employment has been sought in the case of an advance
application, whichever is later, he shall be entitled to a daily unemployment
DOORZDQFHLQDFFRUGDQFHZLWKWKHSURYLVLRQRIWKLVVHFWLRQ
() Subject to such terms and conditions of eligibility as may be prescribed by
the State Government and subject to the provisions of this Act and the Scheme and
the economic capacity of the State Government, the unemployment allowance
payable under sub-section () shall be paid to the applicants of a household,
subject to the guarantee provided under this Act, at such rate as may be
specified by the State Government, by notification, in consultation with the
State Council:
Provided that no such rate shall be less than one-fourth of the notified wage
rate for the first thirty days during the financial year and not less than one-half of
WKHZDJHUDWHIRUWKHUHPDLQLQJSHULRGRIWKHILQDQFLDO\HDU
() The liability of the State Government to pay unemployment allowance to
a household during any financial year shall cease as soon as—
(D) the applicant is directed by the Gram Panchayat or Programme
Officer to report for work either by himself or depute at least one adult member
of the household; or
(E) the period for which employment is sought, comes to an end and no
member of the household of the applicant had turned up for employment; or
(F) the adult members of the household of the applicant have received in
total at least one hundred and twenty-five days of work within the financial
year; or
(G) the household of the applicant has earned as much from the wages
and XQemployment allowance taken together which is equal to the wages for
RQHKXQGUHGDQGWZHQW\ILYHGD\VRIZRUNGXULQJWKHILQDQFLDO\HDU
() The unemployment allowance payable to the household of an applicant
jointly, shall be sanctioned and disbursed by the Programme Officer or such local
authority (including the Panchayat at the District, intermediate or village level) as
WKH6WDWH*RYHUQPHQWPD\E\QRWLILFDWLRQDXWKRULVHLQWKLVEHKDOI
() Every payment of unemployment allowance under sub-section (), shall
be made or offered not later than fifteen days from the date on which it became due
IRUSD\PHQW
() The State Government may prescribe the procedure for the payment of
unemployment allRZDQFHXQGHUWKLV$FW
RI
RI
6 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
CHAPTER IV
IMPLEMENTING AND MONITORING AUTHORITIES
12 () With effect from such date as the Central Government may, by
notification, appoint, there shall be constituted a Council to be NQRZQ DV the
Central Gramin Rozgar Guarantee Council to discharge the functions and perform
WKHGXWLHVDVVLJQHGWRLWXQGHUWKLV$FW
() The Central Council shall consist of Chairperson, representatives of
Central Government and State Governments, not more than fifteen non-official
members representing Panchayati Raj Institutions, organisations of workers and
weaker section of the society and a Member-Secretary not below the rank of Joint
6HFUHWDU\WRWKH*RYHUQPHQWRI,QGLD
() The composition, terms and conditions of appointment, tenure, and
meeting procedures shall be such, as may be prescribed by the Central *RYHUQPHQW
() The Central Council shall perform such functions, duties and advisory
roles relating to evaluation, monitoring, implementation support and reporting
under this Act as may be assigned to it by the Central Government, and the
detailed functions, responsibilities and modalities of functioning shall be such, as
PD\EHSUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
13 () For the purposes of regular monitoring and reviewing the
implementation of the provisions of this Act at the State level, every State
Government shall, by notification, constitute a State Council to be known as the
State Gramin Rozgar Guarantee Council, consisting of a Chairperson and such
number of official members as may be determined by the State Government and
not more than fifteen non-official members nominated by the State Government
from Panchayati Raj Institutions, organisations of workers and weaker section of
the society:
Provided that not less than one-third of the non-official members nominated
under this sub-section shall be women:
Provided further that not less than one-third of the non-official members shall
belong to the Scheduled Castes, the Scheduled Tribes, the Other Backward Classes
DQG0LQRULWLHV
()
The terms and conditions subject to which the Chairperson and
members of the State Council may be appointed and the time, place and
procedure of the meetings (including the quorum at such meetings) of the
&RXQFLOVKDOOEHVXFKDVPD\EHSUHVFULEHGE\WKH6WDWH*RYHUQPHQW
The duties and functions of the State Council shall include—
D advising the State Government on all matters concerning the Scheme
and its implementation in the State;
(E) reviewing the monitoring and redressal mechanisms from time to
time and recommending improvements;
(F) monitoring the implementation of this Act and the Scheme in the
State and coordinating such implementation with the Central Council;
(G) preparing the annual report to be laid before the State Legislature by
the State Government;
(H) any other duty or function as may be assigned to it by the Central
Council or WKH6WDWH*RYHUQPHQW
() The State Council shall have the power to undertake an evaluation of the
Scheme operating in the State and for that purpose to collect or cause to be collected
statistics pertaining to the rural economy and the implementation of the Scheme and
3URJUDPPHVLQWKH6WDWH
Central Gramin
Rozgar
Guarantee
&RXQFLO
State Gramin
Rozgar
Guarantee
&RXQFLO
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 7
National Level
Steering
&RPPLWWHH
State Level
Steering
&RPPLWWHH
14 ) The Central Government shall, by notification, constitute a National
Level Steering Committee to recommend decisions relating to normative allocations
to States and to advise on matters requiring inter-ministerial consultation, including
convergence framework and to provide high level oversight for the effective
LPSOHPHQWDWLRQRIWKLV$FW
() The National Level Steering Committee shall consist of such senior
officials of the Central Government and such other members as may be determined
by the Central Government, and the terms and conditions of their appointment shall
EHVXFKDVPD\EHSUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
() The National Level Steering Committee shall—
(D) recommend decisions relating to normative allocations to States;
(E) recommend policy measures on matters requiring inter-ministerial
consultation, including convergence initiatives and frameworks;
(F) provide high level strategic oversight for effective implementation of
this Act;
(G) review performance of States and recommend corrective or
supportive measures;
(H) facilitate coordination among the Ministries and Departments of the
Central Government and between the Central Government and State
Governments for effective convergence and implementation of the provisions
of this Act;
(I) advise on standards, guidelines, monitoring systems, digital and
geospatial public infrastructure necessary for implementation of the
provisions of this Act; and
(J) perform such other functions as may be assigned to it by the Central
*RYHUQPHQW
15 ) The State Government shall, constitute a State Level Steering
Committee to provide operational guidance, coordination, and monitor the
implementation of WKH6FKHPH
() The State Level Steering Committee constituted under sub-section (),
shall be presided over by the Chief Secretary of the State or by an officer not below
the rank of Additional Chief Secretary nominated by the State Government and shall
comprise of the following members namely:—
(D) Principal Secretary or Secretary of the respective Department;
(E) the Director or Commissioner (in-charge of the Scheme);
(F) Principal Secretaries or Secretaries of relevant Departments of the
State Government;
(G) such number of subject-matter experts, as may be determined by the
State Government;
(H) representatives of technical or research institutions; and
(I) one member nominated by the Department of Rural Development,
Ministry of Rural Development, GovHUQPHQWRI,QGLD
The State Level Steering Committee shall—
D oversee
State
wide
planning
and
convergence
with
other
programmes;
(E) review of district performance and ensure timely preparation of the
aggregate State plan;
8 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
(F) coordinate with the National Level Steering Committee and
implement directions issued therefrom;
(G) support digital systems, monitoring arrangements, and process
improvements at the State level; and
(H) perform such other functions as may be assigned to it by the State
*RYHUQPHQW
16 ) The Panchayats at the district, intermediate and village levels shall be
the principal authorities for planning, implementation and monitoring of the Scheme
made under tKLV$FW
() The Panchayat at the district level, shall oversee and coordinate
implementation of the Scheme in the district, including finalisation and approval of
the aggregate district level plan, supervision and monitoring of works, ensuring
convergence, and perform such other functions as may be assigned to it by the State
*RYHUQPHQW
() The Panchayat at the intermediate level, shall prepare and finalise the
aggregate Block level plan, support Gram Panchayats in planning and
implementation, supervise works at Gram Panchayat and Block levels, DQG
IDFLOLWDWHFRQYHUJHQFHZLWKOLQHGHSDUWPHQWV
() The Gram Panchayat shall register households, receive and process
applications for work, prepare the Viksit Gram Panchayat Plans, execute the works
assigned to it, maintain such records as may be specified by the State Government,
DQGGLVFKDUJHVXFKRWKHUUHVSRQVLELOLWLHVDVPD\EHHQWUXVWHGWRLWXQGHUWKH6FKHPH
17 () The District Collector or any officer of equivalent rank as the State
Government may decide, shall be designated as the District Programme Coordinator
IRUWKHLPSOHPHQWDWLRQRIWKH6FKHPHLQWKHGLVWULFW
() The District Programme Coordinator shall be responsible for the
implementation of the Scheme in the district in accordance with the provisions of
WKLV$FWDQGWKHUXOHVPDGHWKHUHXQGHU
() The functions of the District Programme Coordinator shall be as follows,
namely:—
(D) the District Programme Coordinator shall be responsible for the
consolidation and finalisation of the district aggregate plan and shall oversee
convergence, implementation and monitoring of the Scheme at the district
level in accordance with the provisions of this Act;
(E) the District Programme Coordinator shall ensure compliance with
the provisions of this Act and with the directions and guidelines issued by the
Central Government and the State Government, and shall accord such
administrative sanctions and clearances as may be required for the timely and
effective implementation of the Scheme, including those relating to digital,
geospatial and monitoring systems;
(F) the District Programme Coordinator shall coordinate with Programme
Officers, and shall review, monitor and supervise their performance using the
monitoring framework, management information system and accountability
mechanisms established under this Act and the Scheme;
(G) the District Programme Coordinator shall conduct periodic
inspections of works undertaken under the Scheme, ensure adherence to
quality and productivity standards, and shall redress the grievances of
applicants through digital public infrastructure and designated grievance
redressal systems in such manner as may be prescribed by the Central
*RYHUQPHQW
Principal
authorities for
planning and
implementation
RI6FKHPH
District
Programme
&RRUGLQDWRU
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 9
Programme
2IILFHU
() The Programme Officer and all other officers of the State Government and
local authorities and bodies functioning within the district, shall assist the District
3URJUDPPH&RRUGLQDWRULQFDUU\LQJRXWKLVIXQFWLRQVXQGHUWKLV$FW
() The District Programme Coordinator, shall prepare an aggregate plan for
the district under his jurisdiction by consolidating the approved Viksit Gram
Panchayat Plans and aggregated Block Plans and the proposals received from the
Zila 3DQFKD\DWV
18 () At every Panchayat at intermediate level, the State Government shall
appoint a person who is not below the rank of Block Development Officer with such
qualifications and experience as may be determined by the State Government as
3URJUDPPH2IILFHUDWWKHSDQFKD\DWDWLQWHUPHGLDWHOHYHO
() The Programme Officer shall assist the Panchayat at the intermediate level
in discharging its functions under this Act aQGWKH6FKHPHPDGHWKHUHXQGHU
() The Programme Officer shall be responsible for matching the demand for
employment with the employment opportunities arising from works in the area
XQGHUKLVMXULVGLFWLRQ
() The Programme Officer shall prepare an aggregate plan for the Block
under his jurisdiction by consolidating the approved Viksit Gram Panchayat Plans
DQGWKHSURSRVDOVUHFHLYHGIURPLQWHUPHGLDWHSDQFKD\DWV
() Without prejudice to the generality of sub-section (), the functions of the
Programme Officer shall include—
(D) monitoring all works and projects undertaken by the Gram
Panchayats and other implementing agencies within the Block, ensuring
alignment with the Viksit Gram Panchayat Plans;
(E) sanctioning and ensuring payment of unemployment allowance to
eligible households in accordance with the provisions of this Act;
(F) ensuring prompt and fair payment of wages to all labourers employed
under the Scheme within the Block, including through digital and biometric
authenticated payment systems, as may be specified by the Central
Government;
(G) ensuring that regular social audits of all works within the jurisdiction
of each Gram Panchayat are conducted by the Gram Sabha, and that timely
and appropriate action is taken on objections and findings arising from
such audits;
(H) dealing promptly with all complaints and grievances relating to the
implementation of the Scheme within the Block, through the grievance
redressal mechanisms established under sub-section () of section 25 of
this Act;
(I) ensuring the geo-tagging, digital recording, and management
information system reporting of all works undertaken within the Block, and
compliance with monitoring, productivity, and transparency framework,
specified by the Central Government under this Act;
(J) facilitating inter-departmental convergence at the Block level to
support saturation-driven planning and the execution of works under the
Scheme; and
(K) any other function as may be assigned to him by the District
3URJUDPPH&RRUGLQDWRUDQGWKH6WDWH*RYHUQPHQWXQGHUWKLV$FW
() The Programme Officer shall perform his function under the direction,
control and superintendence of the District 3URJUDPPH&RRUGLQDWRU
10 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
The Gram Panchayat shall be responsible for—
D registration of households and issuance of Gramin Rozgar Guarantee
Cards;
(E) receiving work applications and maintaining records of Gramin
Rozgar Guarantee Cards;
(F) preparing the Viksit Gram Panchayat Plans;
(G) every Gram Panchayat shall, after considering the recommendations
of the Gram Sabha and the Ward Sabhas, keeping in view of the demand for
works, prepare a Viksit Gram Panchayat Plan on saturation basis;
(H) the Programme Officer shall DOORFDWHDWOHDVWILIW\SHUFHQWRIWKH
works in terms of its cost under the Scheme to be implemented through the
Gram Panchayats;
(I) the Programme Officer shall supply each Gram Panchayat with—
(L) the muster rolls for the works sanctioned to be executed by it;
(LL) a list of employment opportunities available elsewhere to the
residents of the Gram Panchayat;
(J) the Gram Panchayat shall allocate employment opportunities among
the applicants and ask them to report for work;
(K) the works taken up by a Gram Panchayat under the Scheme, shall
meet the required technical standards and measurements;
L executing works allotted to it by the Programme Officer; and
M D Gram Panchayat may take up any work under the Scheme from
Viksit Gram Panchayat Plan within the area of the Gram Panchayat, as may
EHVDQFWLRQHGE\WKH3URJUDPPH2IILFHU
20 ) The Gram Sabha, shall monitor and review the execution of all works
undertaken under the Scheme within the jurisdiction of the Gram Panchayat, in
accordance with the provisions of tKLV$FW
() The Gram Sabha shall conduct regular social audits of all works taken up
under the Scheme within the Gram Panchayat, in such manner as may be prescribed
E\WKH&HQWUDO*RYHUQPHQW
() The Gram Panchayat shall make available to the Gram Sabha all records
and documents required for conduct of the social audit, including muster rolls, bills,
vouchers, measurement books, sanction orders, digital records, geo-tagged
photographs, and all other connected books of account and papers, whether
PDLQWDLQHGLQSK\VLFDORUHOHFWURQLFIRUP
21 The State Government, shall provide the necessary staff and technical
support to the District Programme Coordinator and the Programme Officer as may
EHQHFHVVDU\IRUWKHHIIHFWLYHLPSOHPHQWDWLRQRIWKH6FKHPH
CHAPTER V
NATURE OF THE SCHEME AND FUND SHARING PATTERN
22 () The Scheme implemented under this Act shall be a Centrally
6SRQVRUHG6FKHPH
() For the purposes of this Act, the fundsharing pattern between the Central
Government and the State Governments shall be 90:10 for the North Eastern States,
Himalayan States and Union territory (Uttarakhand, Himachal Pradesh and Jammu
DQG.DVKPLUDQG IRUDOORWKHU6WDWHVDQG8QLRQWHUULWRULHVZLWKOHJLVODWXUH
Responsibilities
of Gram
3DQFKD\DWV
Social audit of
works by Gram
6DEKD
Responsibilities
of State
Government in
implementing
6FKHPH
Nature of
Scheme and
fund sharing
SDWWHUQ
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 11
Transparency
and
DFFRXQWDELOLW\
() For the Union territories without legislature, the Central Government shall
bear the entire expenses of the Scheme in the manner as may be prescribed by the
&HQWUDO*RYHUQPHQW
() The Central Government shall determine the State-wise normative
allocation for each financial year, based on objective parameters as may be
SUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
() Any expenditure incurred by a State in excess of its normative allocation
shall be borne by the State Government in such manner and procedure as may be
SUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
() In accordance with the State-wise normative allocation determined under
this Act, the share of the Central Government shall include expenditure towards—
(D) payment of wages for unskilled, semi-skilled and skilled labour
employed under the Scheme;
(E) the material component of works, subject to the provisions in
Schedule I;
(F) such administrative expenses as may be specified by the Central
Government, including salary and allowances of Programme Officers and
supporting staff, administrative expenses of the Central Council, facilities
required under Schedule II, and such other items as may be prescribed by the
&HQWUDO*RYHUQPHQW
() In accordance with the State-wise normative allocation determined under
this Act, the share of the State Government shall include expenditure towards—
(D) payment of wages for unskilled, semi-skilled and skilled labour
employed under the Scheme;
(E) the material component of works, subject to the provisions in
Schedule I;
(F) such administrative expenses as may be specified by the Central
Government, including salary and allowances of Programme Officers and
supporting staff, administrative expenses of the State Council, facilities
required under Schedule II, and such other items as may be prescribed by the
&HQWUDO*RYHUQPHQW
() The State Government, shall bear the expenditure towards unemployment
DOORZDQFHDQGGHOD\FRPSHQVDWLRQDVPD\EHSUHVFULEHGE\WKH6WDWH*RYHUQPHQW
CHAPTER VI
TRANSPARENCY AND ACCOUNTABILITY
23 ) The District Programme Coordinator and all implementing agencies in the
district shall be responsible for the proper utilisation and management of the funds
SODFHGDWWKHLUGLVSRVDOIRUWKHSXUSRVHRILPSOHPHQWLQJWKH6FKHPHXQGHUWKLV$FW
() The manner of maintaining proper books and accounts relating to the
employment of labourers and the expenditure incurred in connection with the
implementation of the provisions of this Act, shall be such, as may be prescribed by
WKH6WDWH*RYHUQPHQW
() The State Government may determine the arrangements to be made for the
proper execution of works under the Scheme and to ensure transparency and
DFFRXQWDELOLW\DWDOOOHYHOVLQWKHLPSOHPHQWDWLRQRIWKH6FKHPHV
() All payments of wages and unemployment allowances shall be made
directly to the person concerned in such manner, as may be prescribed by the Central
*RYHUQPHQW
12 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
() If any dispute or complaint arises concerning the implementation of the
6FKHPHE\WKH*UDP3DQFKD\DWWKHPDWWHUVKDOOEHUHIHUUHGWRWKH3URJUDPPH2IILFHU
() The Programme Officer shall enter every dispute or complaint in a complaint
register maintained by him and shall dispose of such dispute or complaint within a
period of seven days of its receipt; and where the matter relates to any other authority,
LWVKDOOEHIRUZDUGHGWRVXFKDXWKRULW\XQGHULQWLPDWLRQWRWKHFRPSODLQDQW
24:LWKRXWSUHMXGLFHWRWKH foregoing provisions, transparency and accountability
in the implementation of the provisions of this Act, shall be ensured through—
(D) biometric authentication of workers, functionaries, and transactions,
in such manner as may be specified by the Central Government;
(E) geospatial technologyenabled planning, including geo-referencing,
satellite imagery, digital mapping of works, and other approved spatial
technologies, as may be specified by the Central Government;
(F) mobile applicationbased and dashboard-based monitoring systems
providing real-time visibility of demand, works, workforce deployment,
payments, progress and other indicators, as may be specified by the Central
Government;
(G) weekly public disclosure systems, including digital and physical
disclosure of key metrics, muster rolls, payments, sanctions, inspections and
grievances, as may be specified by the Central Government;
(H) strengthening of the social audit mechanism, and the adoption of
suchother technology-enabled systems as may be prescribed by the
&HQWUDO*RYHUQPHQW
25 () The State Government shall, determine a time-bound and multi-tier
grievance redressal mechanism at the Block level and the District level for dealing
with any complaint made by any person in respect of implementation of the
Scheme and lay down the procedure for disposal of such complaints in such
mannerDVPD\EHSUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
() These mechanisms shall address grievances related to applicants, which
include,—
(D) failure of the Gram Panchayat or Programme Officer to provide
employment within the stipulated period referred to in sub-section () of
section 11;
(E) non-payment or delayed payment of wages;
(F) non-payment of unemployment allowance;
(G) lack of specified worksite facilities as specified in Schedule II;
(H) discrimination, harassment, or violation of worker rights, including
those RIZRPHQDQGYXOQHUDEOHJURXSV
26 () The Central Government mayE\UXOHVSURYLGHIRULQ consultation with
WKH &RPSWUROOHU and AuditorGeneral of India, appropriate arrangements for
audits of the accounts of the Schemes at all OHYHOV
() The accounts of the Scheme shall be maintained in such form and in such
manner as may EHSUHVFULEHGE\WKH6WDWH*RYHUQPHQW
CHAPTER VII
MISCELLANEOUS
27 Whoever contravenes any provision of this Act, shall be liable to pay the
penalty which may extend to tHQWKRXVDQGUXSHHV
Technology-
enabled
transparency and
public
DFFRXQWDELOLW\
Grievance
redressal
PHFKDQLVP
Audit of
DFFRXQWV
Penalties for
FRQWUDYHQWLRQ
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 13
Power to
GHOHJDWH
Power of Central
Government to
JLYHGLUHFWLRQV
Act to have
overriding
HIIHFW
Power to amend
6FKHGXOHV
Protection of
action taken in
JRRGIDLWK
Power of Central
Government to
PDNHUXOHV
28 () The Central Government may, by notification, direct that the powers
exercisable by it (excluding the power to make rules) may, in such circumstances
and subject to such conditions and limitations, be exercisable also by the State
Government or such officer subordinate to the Central Government or the State
*RYHUQPHQWDVLWPD\VSHFLI\LQVXFKQRWLILFDWLRQ
() The State Government may, by notification, direct that the powers
exercisable by it (excluding the power to make rules and Schemes) may, in such
circumstances and subject to such conditions and limitations, be exercisable also by
VXFKRIILFHUVXERUGLQDWHWRLWDVLWPD\VSHFLI\LQVXFKQRWLILFDWLRQ
29 () The Central Government may give such directions as it may consider
necessary to the State Government for the effective implementation of the
provisions ofWKLV$FW
() Without prejudice to the provisions of sub-section (), the Central
Government may, on receipt of any complaint regarding any issue or improper
utilisation of funds granted under this Act in respect of any Scheme, if SULPDIDFLH
satisfied that there is a case, cause an investigation into the complaint made by any
agency designated by it and if necessary, order stoppage of release of funds to the
Scheme and institute appropriate remedial measures for its proper implementation
ZLWKLQDUHDVRQDEOHSHULRGRIWLPH
30 The provisions of this Act or the Scheme made thereunder shall have effect
notwithstanding anything inconsistent therewith contained in any other law for the
time being in force or in any instrument having effect by virtue of such law:
Provided that where a State Act exists or is enacted to provide employment
guarantee for unskilled manual work to rural households consistent with the
provisions of this Act under which the guarantee of the households is not less than
and the conditions of employment are not inferior to what is guaranteed under this
Act, the State Government shall have the option of implementing its own enactment:
Provided further that in such cases the financial assistance shall be paid to the
concerned State Government in such manner as shall be determined by the Central
Government, which shall not exceed what the State would have been entitled to
receive under tKLV$FWKDGD6FKHPHPDGHXQGHUWKLV$FWKDGWREHLPSOHPHQWHG
31 () If the Central Government is satisfied that it is necessary or expedient
to do so, it may, by notification, amend 6FKHGXOH
() (very notification issued under sub-section () shall be laidbefore each
House of 3DUOLDPHQW
32 No suit, prosecution or other legal proceedings shall lie against the District
Programme Coordinator, Programme Officer or any other person who is, or who is
deemed to be, a public servant within the meaning of clause () of section 2 of the
Bharatiya Nyaya Sanhita, 2023 in respect of anything which is in good faith done
RULQWHQGHGWREHGRQHXQGHUWKLV$FWRUWKHUXOHVRU6FKHPHVPDGHWKHUHXQGHU
33 () The Central Government shall, by notification, and subject to the
condition of previous publication, make rules to carry out the provisions of this $FW
() In particular, and without prejudice to the generality of the foregoing
power, such rules may provide for all or any of the following matters, namely:—
(D) State-wise normative allocation for each financial year, based on
objective parameters under sub-section () of section 4;
(E) manner and procedure to bear the excess expenditure and its
parameters under sub-section () of section 4;
(F) the composition, terms and conditions of appointment, tenure and
procedure of meeting under sub-section () of section 12;
RI
14 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
(G) the detailed functions, responsibilities and modalities under
sub-section () of section 12;
(H) terms and conditions of appointment of officials of National Level
Steering Committee under sub-section () of section 14;
(I) manner to redress the grievance under clause (G) of sub-section () of
section 17;
(J) manner of conducting social audit by Gram Sabha under
sub-section () of section 20;
(K) manner to bear the expenses of Scheme under sub-section () of
section 22;
(L) objective parameters to determine the State-wise normative allocation
under sub-section () of section 22;
(M) manner and procedure to bear the excess expenditure under
sub-section () of section 22;
(N) other items under clause (F) of sub-section () of section 22;
(O) other items under clause (F) of sub-section () of section 22;
(P) manner of payments of wages and unemployment allowances under
sub-section () of section 23;
(Q)
social audit mechanism, and the adoption of such other
technology-enabled systems under clause (H) of section 24;
(R) manner to lay down the procedure for disposal of complaints under
sub-section () of section 25;
(S) the manner of transfer and vesting under sub-section () of section 37;
(T) any other matter which is to be, or prescribed or in respect of which
SURYLVLRQLVWREHPDGHE\UXOHVIRUFDUU\LQJRXWWKHSURYLVLRQVRIWKLV$FW
34 ) The State Government may, by notification, and subject to the condition
of previous publication, and consistent with the provisions of this Act and the rules
PDGHE\WKH&HQWUDO*RYHUQPHQWPDNHUXOHVWRFDUU\RXWWKHSURYLVLRQVRIWKLV$FW
() In particular, and without prejudice of the foregoing power, such rules may
provide for all or any of the following matters, namely:—
(D) terms and conditions of eligibility under sub-section () of section 11;
(E) the procedure for payment of unemployment allowance under
sub-section () of section 11;
(F) terms, conditions, time, place and procedure of meeting and quorum
under sub-section () of section 13;
(G)
expenditure towards unemployment allowance and delay
compensation under sub-section () of section 22;
(H)
manner of maintaining proper books and accounts under
sub-section () of section 23;
(I) form and manner to maintain the accounts of the Scheme under
sub-section () RIVHFWLRQ
(J)any other matter which is to be, or prescribed or in respect of which
provision is to be made by the State Government, for carrying out the
SURYLVLRQVRIWKLV$FW
35() Every rule made by the Central Government under this Act shall be
laid, as soon as may be after it is made, before each House of Parliament, while it is
in session, for a total period of thirty days which may be comprised in one session
or in two or more successive sessions, and if, before the expiry of the session
immediately following the session or the successive sessions aforesaid, both Houses
agree in making any modification in the rule or both Houses agree that the rule
should not be made, the rule shall thereafter have effect only in such modified form
or be of no effect, as the case may be; so, however, that any such modification or
annulment shall be without prejudice to the validity of anything previously done
under WKDWUXOH
Power of State
Government to
PDNHUXOHV
Laying of rules
DQG6FKHPHV
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 15
Power to remove
GLIILFXOWLHV
Repeal, savings
and transitional
pURYLVLRQV
() Every rule or Scheme made by the State Government under this Act shall,
as soon as may be after it is made, be laid before each House of the State Legislature
where there are two Houses, and where there is one House of the State Legislature,
EHIRUHWKDW+RXVH
36 ) If any difficulty arises in giving effect to the provisions of this Act, the
Central Government may, by order published in the Official Gazette, make such
provisions, not inconsistent with the provisions of this Act, as appear to it to be
necessary or expedLHQWIRUUHPRYLQJWKHGLIILFXOW\
() No order shall be made under this section after the expiry of three years
IURPWKHFRPPHQFHPHQWRIWKLV$FW
() Every order made under this section shall, as soon as may be after it is
made, be laid before each House RI3DUOLDPHQW
37 ) Save as provided in section 10, on and from such date as the Central
Government may by notification appoint in this behalf (hereinafter referred to as the
appointed date), the Mahatma Gandhi National Rural Employment Guarantee
Act, 2005, together with all rules, notifications, Schemes, orders and guidelines
PDGHWKHUHXQGHUVKDOOVWDQGUHSHDOHG
() Notwithstanding such repeal, anything duly done or any action taken under
the repealed Act, including any notification issued, scheme sanctioned, employment
generated, muster roll prepared, wage liability accrued, or proceeding initiated,
shall, in so far as it is not inconsistent with the provisions of this Act, be deemed to
have been done, taken, issued, sanctioned, accrued or incurred under the
corresponding provisions of this Act, as if this Act had been in force at all
PDWHULDOWLPHV
()
All appointments, engagements, authorisations, approvals and
administrative arrangements made under the repealed Act and continuing
immediately before the appointed date shall, unless inconsistent with the provisions
of this Act, continue to be valid and in force until they are altered, superseded or
ZLWKGUDZQXQGHUWKLV$FW
() All inquiries, investigations, audits and legal proceedings pending
immediately before the appointed date shall be continued, heard and disposed of as
if the repealed Act had not been repealed, and such proceedings shall not abate by
UHDVRQRQO\RIVXFKUHSHDO
() All assets, liabilities, records, funds and obligations arising under, or
relating to, the repealed Act shall stand transferred to and vest in the authorities
constituted under this Act and shall be dealt with in such manner as may be
SUHVFULEHGE\WKH&HQWUDO*RYHUQPHQW
RI
16 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
SCHEDULE I
[See section 8(3@
Minimum features of Viksit Bharat—Guarantee for Rozgar and Ajeevika Mission
(Gramin): VB—G RAM G (ĮęøĮĝć Đĭēć—ÿı ēĭđ ÿı) Scheme
7KH6FKHPHQRWLILHGXQGHUVHFWLRQRIWKH$FWE\DOO6WDWHVVKDOOEHFDOOHG
the “Viksit Bharat—Guarantee for Rozgar and Ajeevika Mission (Gramin):
VB—G RAM G (ĮęøĮĝć Đĭēć—ÿı ēĭđ ÿı) Scheme” and all documents pertaining
to the said Scheme shall have a mention of the Viksit Bharat—Guarantee for Rozgar
and Ajeevika Mission (Gramin): VB—G RAM G (ĮęøĮĝć Đĭēć—ÿı ēĭđ ÿı)
$FW
All Scheme documents pertaining to the said Scheme shall have a mention
of the Viksit Bharat—Guarantee for Rozgar and Ajeevika Mission (Gramin):
VB—G RAM G (ĮęøĮĝć Đĭēć—ÿı ēĭđ ÿı) $FW
The core objectives of the Scheme shall be as follows:—(a) The primary
objective of this Act is to align the rural development framework with the national
vision of Viksit Bharat @2047 by providing an enhanced statutory wage-
employment guarantee of one hundred and twenty-five days in each financial year
to such rural households whose adult members volunteer to undertake unskilled
manual work, thereby enabling them to participate more effectively in the expanded
OLYHOLKRRGVHFXULW\IUDPHZRUN
(b) To focus on empowerment, growth, convergence and saturation through
public works aggregating into forming Viksit Bharat National Rural Infrastructure
Stack, with a thematic focus on water security through water-related works, core
rural infrastructure, livelihood-related infrastructure and special works to mitigate
extrHPHZHDWKHUHYHQWV
(c) To facilitate adequate farm-labour availability during peak agricultural
seasons, and, in view of the wage-employment guarantee for the rural wRUNIRUFH
(d) To institutionalise convergence, saturation-driven planning and whole of
government delivery through Viksit Gram Panchayat Plans, integrated with the PM
Gati Shakti to address the varying needs of Gram Panchayats, powered by geospatial
systems, digital public infrastructure, district and State planning mechanisms, with
VXFKSODQVDJJUHJDWHGDWWKH%ORFN'LVWULFW6WDWHDQG1DWLRQDOOHYHOV
(e) To modernise governance, accountability and citizen engagement through a
comprehensive digital ecosystem, including biometric authentication at various levels,
global positioning system or mobile based worksite monitoring, real time
management information system dashboards, proactive public disclosures and the use
RI$UWLILFLDO,QWHOOLJHQFHIRUSODQQLQJDXGLWVDQGIUDXGULVNPLWLJDWLRQ
Works under the Scheme—(1) Focus of the Scheme—Classification of
Works: The Scheme shall focus on the following categories of works, as identified
in the Viksit Gram Panchayat Plans and aggregated into the Viksit Bharat National
5XUDO,QIUDVWUXFWXUH6WDFN
(2) For the purposes of section 4 of the Act, the works to be taken up under
the Scheme, shall fall under the following Categories, together with their thematic
focus and intended outcomes, namely:—
(a) Category I—Water-Related Works (for Water Security)—
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 17
(A) The focus shall include conservation, irrigation, groundwater
recharge, source sustainability, rejuvenation of water bodies, watershed
development and afforestation and the Illustrative works include—
(i) construction of canals, flood or diversion channels, check
dams, gully plugs and underground dykes;
(ii) construction or rejuvenation of ponds, percolation tanks,
recharge pits, recharge shafts, injection wells and associated water
harvesting structures;
(iii) irrigation open wells, micro-irrigation channels and field
water distribution systems;
(iv) reclamation of community waterlogged land;
(v) afforestation and plantation works linked with soil and
moisture conservation; and
(vi) rooftop rainwater harvesting and other decentralised
UHFKDUJHV\VWHPV
(B) Intended Outcomes—Strengthening of water security through
integrated water resource management, recharge and conservation for
long-WHUPFOLPDWHUHVLOLHQFH
(b) Category II—Core Rural Infrastructure—
(A) Thematic focus shall include core civic, social, governance and
service-delivery infrastructure relating to education, health, drinking
water, sanitation, connectivity, renewable energy and community
services and the Illustrative works include—
(i) construction or upgradation of rural roads, culverts, cross-
drainage structures and village connectivity facilities;
(ii) construction of Gram Panchayat Bhawans, Anganwadi
centres, rural libraries and other public buildings;
(iii) construction of school infrastructure, including kitchen
sheds, additional classrooms, laboratories, compound walls and
playgrounds;
(iv) crematoria and community infrastructure;
(v) solid and liquid waste management assets, including
stabilising ponds, community sanitary complexes, and waste
segregation and collection centres;
(vi) installation of solar lighting systems and other renewable
rural energy infrastructure;
(vii) village parking areas, transport sheds and other common
rural amenities;
(viii) rural housing works permissible under the schemes of
the Central Government, including those permitted under the
Pradhan Mantri Awas Yojana—Gramin; DQG
(ix) repair and maintenance of works created under the Jal
Jeevan Mission for ensuring water suppl\
(B) Intended Outcome—Creation of foundational civic and social
infrastructure ensuring basic amenities, improved service access and
HQKDQFHGTXDOLW\RIOLIHLQUXUDODUHDV
(c) Category III—Livelihood-related Infrastructure—
18 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
($) Thematic focus shall include productive assets and facilities
that enhance rural livelihoods through agriculture, livestock, fisheries,
value addition, skilling and enterprise development and the Illustrative
works include—
(L) construction of training-cum-skill development centres
and work sheds for livelihood activities;
(LL) rural haats or weekly markets and other market
infrastructure;
(LLL) food grain storage buildings, agricultural produce
storage structures, cold storage units and other agri-value chain
infrastructure;
(LY) buildings for Self Help Groups and federation-level
institutions;
(Y) compost structures, including vermicompost and NADEP
units;
(YL)
development
of
silvipasture
grasslands,
dairy
infrastructure and shelters for cattle, goats, pigs, poultry and other
livestock;
(YLL) fisheries-related infrastructure, including fish drying
yards;
(YLLL) raising of nurseries and production of building material;
and
(L[) Integrated projects promoting circular and cyclical
HFRQRP\PRGHOVDVPD\EHDSSURYHGE\WKH&HQWUDO*RYHUQPHQW
(%) Intended Outcome—Strengthening of sustainable livelihoods,
value addition, enterprise development and self-UHOLDQWUXUDOHFRQRPLHV
(G) Category IV—Special works to mitigate Extreme Weather Events
and Disaster Preparedness—
($) Thematic focus shall include disaster risk reduction,
climate adaptation, and protection of rural communities and assets
from floods, cyclones, storms, droughts, landslides, forest fires and
other extreme weather events and the Illustrative works include—
(L) construction of cyclone shelters, flood shelters and
multipurpose disaster resilient structures;
(LL) construction of diversion channels, embankments
and other disaster-mitigation works;
(LLL) stabilising ponds and water structures for flood
management;
(LY) post-disaster rehabilitation, restoration and repair
of rural roads and community assets;
(Y) windbreak and shelterbelt plantations; and
(YL) forest fire management works, including fire
EUHDNVIXHOEXIIHU]RQHVDQGDOOLHGPHDVXUHV
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 19
(%)
Intended Outcome—Creation of climate-resilient
YLOODJHVFDSDEOHRIZLWKVWDQGLQJH[WUHPHZHDWKHUFRQGLWLRQV
( $Q\RWKHUSXEOLFZRUNZKLFKPD\EHQRWLILHGE\WKH&HQWUDO*RYHUQPHQW
() Maintenance of rural public assets created under the Act
() Works for individual beneficiaries, including but not limited to housing-
related works under the Pradhan Mantri Awaas Yojana—Gramin, sanitation-related
works, and other beneficiary-oriented developmental works undertaken under
various schemes of the Central Government from time to time and expressly notified
IRU LQFOXVLRQ XQGHU WKH 6FKHPH PD\ DOVR EH WDNHQ XS 7KH HOLJLELOLW\ RI VXFK
beneficiaries shall be as notified by the Central Government, aligned with the
eligibility criteria specified under the respective Central Government schemes, with
all such works conforming to the norms, standards and guidelines issued by the
&HQWUDO*RYHUQPHQW
() Without prejudice to the generality of the above, works creating individual
assets as notified by the Central Government shall be prioritised on land or
homestead owned by households belonging to—
(D) the Scheduled Castes;
(E) the Scheduled Tribes;
(F) nomadic tribes;
(G) denotified tribes;
(H) economically weaker sections of the society as identified based on
criteria notified by the Central Government;
I women-headed households;
J households headed by persons with disabilities;
K beneficiaries of land reforms;
L beneficiaries under the Pradhan Mantri Awaas Yojana—*UDPLQ
(PMAY-G); and
(M)
beneficiaries
under
the
Scheduled
Tribes
and
Other
7UDGLWLRQDO )RUHVW 'ZHOOHUV 5HFRJQLWLRQ RI )RUHVW 5LJKWV $FW
(2 of 2007), and
after exhausting the eligible beneficiaries under the above categories, works may be
taken up on the lands of small or marginal farmers as identified on the basis of
criteria notified by the Central Government, subject to such conditions as may be
notified by the Central Government, including the requirement that such households
possess a valid job card and have at least one adult member willing to work on the
SURMHFWXQGHUWDNHQRQWKHLUODQGRUKRPHVWHDG
3DUWLFLSDWRU\3ODQQLQJXQGHUthe Scheme:—() All Central, State or local
schemes, as may be notified by the Central Government for the purpose of
convergence and saturation-based planning, shall be brought under a unified
SODQQLQJSURFHVVDQFKRUHGLQWKH9LNVLW*UDP3DQFKD\DW3ODQV
() There shall be a systematic and participatory planning exercise
undertaken at each tier of the Panchayati Raj system in accordance with
WKH VSHFLILHG PHWKRGRORJ\ 7KH 9LNVLW *UDP 3DQFKD\DW 3ODQV VKDOO EH
prepared by the Gram Panchayats using GIS-based tools, PM Gati Shakti layers
and other digital public infrastructure, and placed before the Gram Sabha for
20 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
DSSURYDO:RUNVSURSRVHGto be undertaken by the Intermediate Panchayat,
District Panchayat or other implementing agencies shall likewise be placed before
WKHUHVSHFWLYH3DQFKD\DWVDORQJZLWKWKHH[SHFWHGRXWSXWVDQGRXWFRPHV7KH9LNVLW
Gram Panchayat Plans shall be aggregated at the Block, District and State levels to
ensure coherence with sectoral priorities, broader rural development strategies, and
saturation-based planning for comprehensive coverage of eligible assets and
RXWFRPHVDFURVVDOO*UDP3DQFKD\DWV$OOZRUNVHPHUJLQJIURPWKH9LNVLW*UDP
Panchayat Plans shall be consolidated into the Viksit Bharat—National Rural
,QIUDVWUXFWXUH6WDFN
(3) Viksit Gram Panchayat Plan—Every Gram Panchayat shall prepare
saturation-PRGH SODQV EDVHG RQ LWV FODVVLILFDWLRQ LQWR &DWHJRU\ $ % & HWF
determined based on development parameters, including proximity to urban areas,
WRDGGUHVVWKHYDU\LQJQHHGVRIWKH3DQFKD\DWV$OOVXFKZRUNV shall be drawn
exclusively from the approved Viksit Gram Panchayat Plan, prepared using PM Gati
Shakti, GIS-EDVHGWRROVDQGRWKHUGLJLWDOSXEOLFLQIUDVWUXFWXUH
(4) The works identified in the Viksit Gram Panchayat Plans shall be executed
through various &HQWUDO6WDWHDQGORFDOVFKHPHVLQFRQYHUJHQFH7KHVFKHPHVWR
EHWDNHQXSIRUVXFKFRQYHUJHQFHVKDOOEHQRWLILHGE\WKH&HQWUDO*RYHUQPHQW
)UDPHZRUN IRU &RQYHUJHQFH DQG ,QWHJUDWHG 3ODQQLQJ—A Unified
Convergence Framework shall be established for coherent planning, execution and
monitoring of all works undertaken in rural areas, and for this purpose—
(1)All Central, State or local schemes, as may be notified by the Central
Government for the purpose of convergence and saturation-based planning,
shall be brought under a unified planning process anchored in the Viksit Gram
Panchayat Plans
(2)All existing assets and proposed works, whether funded under this
Act or through any other Central, State or local scheme, shall be mandatorily
registered and tracked through the Viksit Bharat—National Rural
Infrastructure Stack using the designated digital portal, which shall maintain a
comprehensive register of rural public works, prevent duplication, integrate
GHSDUWPHQWDOLQYHVWPHQWVDQGDOLJQDOOZRUNVZLWKVDWXUDWLRQRXWFRPHV
(3)The Ministry of Rural Development shall prepare and periodically
update the management information system, a nationally harmonised, single
digital backbone for rural public works covering water security, core rural
infrastructure, livelihood-related infrastructure, and special works to mitigate
extreme weather events; and all planning shall follow a strict bottom-up
process beginning with the preparation of the Viksit Gram Panchayat Plan,
which shall be successively aggregated at the Block, District and State levels,
and the aggregated State Plan shall be placed before the State Level Steering
&RPPLWWHHIRUDSSURYDO
(4)Viksit Bharat National Rural Infrastructure Stack shall guide States,
Districts and Panchayati Raj Institutions in identifying priority infrastructure
gaps, standardising work designs, and ensuring that public investments
contribute measurably to saturation outcomes at the Gram Panchayat, Block
DQG'LVWULFWOHYHOV
(5)
This
institutional
architecture
shall
ensure
a
single-plan,
multi-funding
approach,
promote
convergence
across
departments
and
schemes, and align all rural development efforts with the Viksit Bharat #2047
YLVLRQRIFUHDWLQJSURGXFWLYHUHVLOLHQWDQGWUDQVIRUPDWLYHUXUDODVVHWV
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 21
Intra-State distribution of normative Allocation—The State Government
shall, upon receipt of the approved normative allocation from the Central
Government, ensure equitable, need-based and transparent intra-State distribution
of the allocation across districts and Gram Panchayats, taking into consideration
the categorisation of Gram Panchayats and the assessed local needs for
determining Gram Panchayat-wise allocations and corresponding district
allocations;
and
the detailed methodology, parameters and procedural
UHTXLUHPHQWVIRUVXFKGLVWULEXWLRQVKDOOEHQRWLILHGE\WKH&HQWUDO*RYHUQPHQW
Completion of Ongoing Works—At the time of opening new works, it
shallbe ensured that ongoing or incomplete works are prioritised for completion,
VXEMHFWWRSODQQLQJQRUPVDQGWKHDSSURYHG9LNVLW*UDP3DQFKD\DW3ODQV
Technical Estimates and Standards for Works—Every work under this Act
shall have a technical estimate and design sanctioned by an authority authorised by
the State Government, based on the framework aligned with the Viksit Bharat
1DWLRQDO 5XUDO ,QIUDVWUXFWXUH 6WDFN
For works involving construction, appropriate labour-intensive
technologies, depending upon the availability of labour and the use of local
PDWHULDOVVKDOOEHHPSOR\HGWRWKHH[WHQWIHDVLEOH
Bills of quantities shall use clear and commonly understood terminology
to ensure transparency for all VWDNHKROGHUV
Each work shall have a summary of the estimate, design and a technical
QRWHLQGLFDWLQJWKHH[SHFWHGRXWSXWVDQGRXWFRPHV
All technical estimates, designs and outcome notes shall be generated or
uploaded through digital systems integrated with the designated management
LQIRUPDWLRQV\VWHP
Administrative and Financial Sanctions—(1) Works finalised at the
Gram Panchayat level through the approved Viksit Gram Panchayat Plan and
aggregated at the Block and District levels shall be accorded administrative or
financial sanction by the competent authority as per the requirements and within
WKLUW\GD\V
(2) The sanctioning authorities shall ensure that—
(a) the proposed works are drawn exclusively from the approved Viksit
Gram Panchayat Plan;
(b) the works are consistent with thematic domains, and the Viksit
Bharat National Rural Infrastructure Stack;
(c) all sanctioned works are taken up through the designated digital
SRUWDOXQGHUWKH$FW
0XVWHU 5ROOV DQG $WWHQGDQFH 6\VWHPV—The muster rolls for works
undertaken under this Act shall be maintained through digital systems and shall
comply with the following requirements—
(a) Each muster roll shall be in English and the local language and have
a unique electronically generated identity number (e-muster) issued through
WKHPDQDJHPHQWLQIRUPDWLRQV\VWHP7KHPXVWHUUROOVKDOOLQFOXGHWKHQDPHV
of all workers who have demanded or been allocated work and shall be
authenticated by the authorised functionary of the Gram Panchayat or the
3URJUDPPH2IILFHU
(b) Attendance at the worksite shall be recorded daily by an authorised
person using biometric attendance systems, and all attendance details shall be
made available for public viewing on a daily basis through the designated
PDQDJHPHQWLQIRUPDWLRQV\VWHP
22 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
(F) e-Muster rolls shall be processed by officials in the manner stipulated
XQGHUWKHUHOHYDQWJXLGHOLQHV
Measurement and Basis for Payment—() Payment of wages shall only be
made based on measurements taken at the worksite by authorised technical
personnel within three days of the closure of the muster roll, and recorded digitally
through systems integrated wLWKWKHGHVLJQDWHGPDQDJHPHQWLQIRUPDWLRQV\VWHP
() The State Government shall ensure the deployment of adequate technical
SHUVRQQHO WR HQDEOH WLPHO\ PHDVXUHPHQW 6XLWDEOH SHUVRQV PD\ EH WUDLQHG DQG
deployed, with delegated technical responsibilities, and shall be paid wages at
VNLOOHGUDWHV
:DJH/LQNDJHWR2XWSXWDQG6FKHGXOHRI5DWHV—The State Government
shall ensure that wages without any gender bias are linked to the quantum of work
completed, in accordance with the Rural Schedule of Rates notified on the basis of
time-and-motion studies for different types of work and different seasons, and
UHYLVHGSHULRGLFDOO\
6SHFLDO6FKHGXOHRI5DWHVIRU9XOQHUDEOH*URXSV—A separate Schedule
of Rates shall be finalised for women, the elderly, persons with disabilities and
persons with debilitating ailments to facilitate their productive participation in
VXLWDEOHFDWHJRULHVRIZRUN
:RUNLQJ+RXUVDQG(DUQLQJ1RUPV—(D) The Schedule of Rates shall be
framed so that an adult person working for eight hours, inclusive of one hour of rest,
FDQHDUQDQDPRXQWHTXLYDOHQWWRWKHQRWLILHGZDJHUDWH
(E) Working hours of an adult worker may be flexible but shall not extend
EH\RQGWZHOYHKRXUVLQDGD\LQFOXGLQJLQWHUYDOVIRUUHVW
0DWHULDO&RPSRQHQW—For all works undertaken under this Act, the cost
RIWKHPDWHULDOFRPSRQHQWVKDOOQRWH[FHHGIRUW\SHUFHQWDWWKH'LVWULFWOHYHO
([HFXWLRQ:LWKRXW&RQWUDFWRUV—() No contractor shall be engaged for
the execution of any work or component financed through expenditure under this
$FW$OOVXFKZRUNVVKDOOEHH[HFXWHGGLUHFWO\E\WKHLPSOHPHQWLQJDJHQFLHVLQ
accordance with the processes laid down under the Act, including mandatory
SURDFWLYHGLVFORVXUHVDQGWKHVRFLDODXGLWSURFHVV
() In cases of convergence where components of a work are financed under
other schemes, the execution of those components may follow the norms of the
FRQYHUJLQJVFKHPHLQFOXGLQJWKHXVHRIFRQWUDFWRUVZKHUHSHUPLWWHG
$VIDUDVSUDFWLFDEOHZRUNVH[HFXWHGE\WKHSURgramme implementation
agencies shall be performed by using manual labour and no labour displacing
PDFKLQHVVKDOOEHXVHG
7UDQVSDUHQW 3URFXUHPHQW RI 0DWHULDOV—All materials required for the
execution of works shall be procured by the Gram Panchayat or the implementing
agency through transparent procurement systems, including e-tendering processes,
DVVSHFLILHGE\WKH6WDWH*RYHUQPHQW
2XW RI WKH DGPLQLVWUDWLYH FRVWV DOORZHG XQGHU WKH 6FKHPH DW OHDVW
one-third shall be utilised at the Gram Panchayat level to employ and pay the Gram
Rozgar Sahayak, other technical personnel as per the work done and for other
DGPLQLVWUDWLYHH[SHQVHV
7UDQVSDUHQF\DQG$FFRXQWDELOLW\—() Every Scheme prepared under this
Act shall contain comprehensive provisions to ensure transparency and
accountability at all levels of implementation, including Mandatory Public
Disclosure and social audit
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 23
(2) Mandatory Public Disclosure—(a) Mandatory Public disclosure shall be
undertaken through digital systems integrated with the designated management
LQIRUPDWLRQV\VWHPDQGGLVSOD\HGDWWKHYLOODJHOHYHOIRUSXEOLFVFUXWLQ\
(b) Display at every worksite a “Janata Board” indicating details of
the work, estimated labour days, material quantities in local terminology, and
LWHPZLVHFRVWV
(c) Digital and physical display of number of days of employment provided,
wage payments, material payments, guarantees under the Act, works approved
under the Viksit Gram Panchayat Plan, and year-wise works taken up or completed
E\WKH*UDP3DQFKD\DWDQGRWKHULPSOHPHQWLQJDJHQFLHV
(d) Public disclosure of all information relating to works, labour demand,
employment provided, payments, material utilisation and physical progress under
this Act shall be carried out through digital systems integrated with the designated
SRUWDO :HHNO\ GLVFORVXUHV VKDOO EH DXWRPDWLFDOO\ JHQHUDWHG DQG GLVSOD\HG LQ D
SXEOLFO\DFFHVVLEOHSK\VLFDODQGGLJLWDOIRUPDWV,QDGGLWLRQWKH*UDP3DQFKD\DW
shall convene weekly disclosure meetings in the Gram Panchayat Bhawan to
present the status of works, payments, grievances and other relevant information
EHIRUHWKHFRPPXQLW\
(e) The Ministry of Rural Development and the State Departments shall
ensure that their official websites are regularly updated in compliance with
clause (b) of sub-section (1) of section 4 of the Right to Information Act, 2005
(22 of 2005), with all information on the Act available in free, downloadable
HOHFWURQLFIRUP
(3) Social audit—(a) all works, expenditures and guarantees under this Act
shall be subject to social audit at least once every six months in the manner as may
be prescribed by the Central Government;
(b) the procedure, standards and modalities for conducting social audits shall
be as prescribed in the rules made under this Act;
(c) until such rules are notified, the provisions of the Mahatma Gandhi
National Rural Employment Guarantee Audit of Schemes Rules, 2011 shall,
mutatis mutandisDSSO\WRWKHFRQGXFWRIVRFLDODXGLWVXQGHUWKLV$FW
(4)
Concurrent
evaluation
mechanism—For
ensuring
measurable
outcomes and real-time accountability, technology-enabled monitoring shall be
mandated for tracking work execution and post-completion asset outcomes,
VXSSRUWHG E\ YHULILHG GDWD V\VWHPV DQG VSDWLDO WHFKQRORJLHV :HHNO\ SXEOLF
GLVFORVXUHVVKDOOEHUHLQIRUFHGWKURXJKDFRPSUHKHQVLYHWUDQVSDUHQF\IUDPHZRUN
A Concurrent Evaluation Mechanism, as may be specified by the Central
Government through guidelines, shall provide continuous vigilance and enable
WLPHO\FRUUHFWLYHDFWLRQ
Recovery of misappropriated amounts—(1) Any misappropriation of
amounts spent under the Act shall be recoverable under the relevant revenue laws
IRUUHFRYHU\SUHYDLOLQJLQWKH6WDWH
(2) The portion of such recoveries pertaining to the Central share shall be
remitted to the Consolidated Fund of India through the mechanism established by
WKH&HQWUDO*RYHUQPHQW
24 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
,QVSHFWLRQ DQG 4XDOLW\ &RQWURO—The State Government shall ensure
regular inspection and supervision of works by designated quality-control teams to
verify adherence to quality standards, accuracy of measurements and conformity of
ZDJHSD\PHQWVWRWKHDFWXDOTXDQWXPRIZRUNH[HFXWHG,QVSHFWLRQUHSRUWVVKDOOEH
XSORDGHGWRWKHPDQDJHPHQWLQIRUPDWLRQV\VWHP
*ULHYDQFH 5HGUHVVDO 0HFKDQLVP—An effective grievance redressal
mechanism shall be established under the Act, comprising the following
components, namely:—
(D) Institutional mechanisms for receiving grievances at the Ward, Gram
Panchayat, Block and District levels, with at least one designated day each
week when officials shall be mandatorily available to receive grievances;
(E) Issuance of a dated acknowledgement for all grievances submitted in
writing, telephonically, online, or orally to any authorised functionary;
(F) Enquiry through spot verification or inspection and disposal shall be
completed within seven working days of receipt of the grievance;
(G) Upon completion of the enquiry, the concerned authority shall
initiate immediate corrective action, and the grievance shall be resolved within
fifteen days;
(H) Failure to dispose of a grievance within seven working days at the
level determined, shall be treated as a contravention of the provisions of this
Act and shall attract action in accordance with section 27 or any corresponding
provision of this Act;
(I) Where SULPD IDFLH evidence of financial irregularity is revealed
during preliminary enquiry or through findings of the social audit report, the
District Programme Coordinator shall, after obtaining legal advice, ensure that
a First Information Report is lodged and necessary proceedings initiated;
(J) The concerned authority shall inform the complainant in writing,
physically or digitally, of the conclusions of the enquiry and the steps taken
for redressal;
(K) Action taken on grievances received by all implementing agencies
shall be placed before the meetings of the Intermediate Panchayat and the
District Panchayat for review and monitoring;
(L) Appeals against the orders of the Gram Panchayat shall lie
before the Programme Officer; appeals against the orders of the Programme
Officer shall lie before the District Programme Coordinator; appeals against
the orders of the District Programme Coordinator shall lie before the State
Grievance Redressal Authority or any officer designated by the State
Government;
(M) All appeals shall be filed within forty-five days from the date of the
order;
(N) All appeals shall be disposed of within thirty days from the date of
receipt;
(O) Any grievance not resolved within fifteen days at the Ward, Gram
Panchayat, Block or District level shall be automatically escalated to the next
higher level through digital systems integrated with the designated
management information system, and such escalations shall be continuously
monitored elHFWURQLFDOO\
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 25
2PEXGVSHUVRQ—The State Government shall appoint an Ombudsperson
for each District to receive grievances, conduct enquiries and issue awards in
DFFRUGDQFHZLWKWKHJXLGHOLQHVQRWLILHGE\WKH&HQWUDODQGWKH6WDWH*RYHUQPHQWV
The Ombudsperson shall operate through digital platforms integrated with the
GHVLJQDWHGGLJLWDOSRUWDOXQGHUWKLV$FW
$FWLRQIRU&RQWUDYHQWLRQ—Wherever contravention of any provision of
this Act is established after due enquiry by the State Government, the District
Programme Coordinator, the Programme Officer, the Ombudsperson or any other
authority authorised by the State Government, action shall be taken in accordance
ZLWKVHFWLRQRIWKLV$FWRUDQ\FRUUHVSRQGLQJSURYLVLRQ
$QQXDO5HSRUWLQJ—The District Programme Coordinator, the Programme
Officer and each Gram Panchayat shall prepare an annual report detailing facts,
figures and achievements relating to the implementation of the Scheme within their
MXULVGLFWLRQ$FRS\RIVXFKUHSRUWVKDOOEHPDde available to the public in physical
RUHOHFWURQLFIRUPRQSD\PHQWRIVXFKIHHDVPD\EHVSHFLILHGLQWKH6FKHPH
$OODFFRXQWVDQGUHFRUGVLQFOXGLQJPXVWHUUROOVUHODWLQJWRWKHVFKHPHVKDOO
EHPDGHDYDLODEOHIRUSXEOLFVFUXWLQ\IUHHRIFRVW$Q\SHrson desirous of obtaining
a copy or relevant extracts therefrom may be provided such copies or extracts on
GHPDQGQRWODWHUWKDQWKUHHZRUNLQJGD\VIURPWKHGDWHRIUHFHLSWRIDSSOLFDWLRQ
&DSDFLW\ %XLOGLQJ DQG 6WUHQJWKHQLQJ 3DQFKD\DWV—There shall be a
dedicated plan for training, Information Education Communication, digital literacy
DQGVWUHQJWKHQLQJ3DQFKD\DWL5DM,QVWLWXWLRQV
26 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
SCHEDULE II
[6HH section 9(@
*UDPin Rozgar Guarantee Card—() Household Registration—The adult
member of every household residing in any rural area and willing to undertake
unskilled manual work, may submit the names, ages and address of the household
to the Gram Panchayat within whose jurisdiction they reside, for the purpose of
registration of the household and issuance of a Gramin 5R]JDU*XDUDQWHH&DUG
() Special Gramin Rozgar Guarantee Card, where the job seeker is—
(D) a single woman; or
(E) a person with disability; or
(F) persons above sixty years of age; or
(G) a released bonded labourer; or
(H) a person belonging to a Particularly Vulnerable Tribal Group; or
(I DWUDQVJHQGHUSHUVRQ
() The Special Gramin Rozgar Guarantee Card of a distinct colour, shall
ensure special protection in the providing work, work evaluation, and worksite
facilities, as applicable
() It shall be the duty of the Gram Panchayat, after making such enquiry, as
it deems fit, to issue a Gramin Rozgar Guarantee Card within fifteen days from the
date of receipt of such application, containing therein a unique Gramin Rozgar
Guarantee Card number with details of the registered adult members of the
household, their photos, Bank or Post office account number, insurance policy
number and the Aadhaar numbers, LIDQ\
() The Gramin Rozgar Guarantee Card issued, shall be valid for three years,
DIWHUZKLFKLWPD\EHUHQHZHGDIWHUGXHYHULILFDWLRQ
() No Gramin Rozgar Guarantee Card shall be cancelled except on any of the
following grounds—
(D) where it is found to be a duplicate;
(E) where the entire household has permanently migrated to a place
outside the jurisdiction of the Gram Panchayat and no longer resides in the
village; or
(F) where all adult members of the registered household are deceased
() The State Government shall make arrangements for updating the following
details in the *UDPLQRozgar Guarantee Card regularly while mentioning the key
guarantees under the Act are clearly listed as follows:—
(D) number of days for which work was demanded;
(E) number of days of work allocated;
(F) description of the work allocated along with the muster roll number;
(G) measurement details;
(H) unemployment allowance, if any, paid;
(I) date-wise amount of wages paid;
(J) delay compensation paid if any;
(K DVVHWSURYLGHGLIDQ\
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 27
'HPDQG IRU ZRUN—() Every adult member of a registered household
whose name appears in the Gramin Rozgar Guarantee Card, shall be entitled to
apply for unskilled manual work under the Scheme; and every such application shall
be compulsorily registered, and a receipt issued with the date, which shall be entered
LQWKHJLYHQGLJLWDOSODWIRUP
() The State shall proactively verify the requirements of the Vulnerable
*URXSVDQGSURYLGHWKHPZLWKZRUN
() Application for work may be oral or written and made to the Ward member
or to the Gram Panchayat or to the Programme Officer or any person authorised by
the State Government or through digital platforms, or through any other means
DXWKRULVHGE\WKH6WDWH*RYHUQPHQW
() Applications for work may EHILOHGLQGLYLGXDOO\RUIRUDJURXSWRJHWKHU
() There shall be no limit on the number of days of employment for which a
person may apply, or on the number of days of employment actually provided to
KLPVXEMHFWWRWKHDJJUHJDWHJXDUDQWHHRIWKHKRXVHKROG
() Normally, applications for work must be for at least six days of continuous
work
() Provision shall be made in the Scheme for advance application, that is,
application which may be submitted earlier than the date from which employment
LVVRXJKW
() Provision shall be made in the Scheme for submission of multiple
applications by the same person provided that the corresponding periods for which
HPSOR\PHQWLVVRXJKWGRQRWRYHUODS
$OORFDWLRQRIZRUN—() The Gram Panchayat and Programme Officer shall
ensure that every applicant shall be provided unskilled manual work in accordance
with the provisions of the Scheme within fifteen days of receipt of an
application or the date from which he seeks work in case of advance application,
ZKLFKHYHULVODWHU
() Priority shall be given to women in such a way that at least one-third of
WKH EHQHILFLDULHV VKDOO EH ZRPHQ ZKR KDYH UHJLVWHUHG DQG UHTXHVWHG IRU ZRUN
Efforts to increase participation of single women and the person with disabilities
VKDOOEHPDGH
() Applicants who are provided with work shall be so intimated
in writing, by means of a letter sent to him at the address given in the *UDPLQ
RozgarGuarantee Card or through any other effective mode of communication
or by a public notice displayed at the office of the Panchayats at district,
LQWHUPHGLDWHRUYLOODJHOHYHO
()A list of persons who are provided with the work shall be displayed on the
notice board of the Gram Panchayat and at the office of the Programme Officer and
at such other place as the Programme Officer may deem necessary and the list shall
EHRSHQIRULQVSHFWLRQE\WKH6WDWH*RYHUQPHQWDQGDQ\LQWHUHVWHGSHUVRQ
()As far as possible, the employment shall be provided within a radius of
five kilometers of the village where the applicant resides at the time of appl\LQJ
28 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
() A new work under the Scheme can be commenced if at least ten labourers
become available for work, provided that this condition shall not be applicable for
new works, as determined by the State Government, in hilly areas and in respect of
afforestation woUNV
() In case the employment is provided outside the radius specified in
sub-paragraph () of paragraph 3, it shall be provided within the Block, and the
labourers shall be paid ten per cent of the wage rate as extra wages to meet
additionaOWUDQVSRUWDWLRQDQGH[SHQVHVIRUOLYLQJ
() A period of employment shall be for at least six days continuously, with
QRWPRUHWKDQVL[GD\VLQDZHHN
:RUNVLWH PDQDJHPHQW—() For the purpose of transparency at the
worksite, the following shall be ensured—
(D) there shall be a project initiation meeting in which various provisions
of the work shall be explained to the workers;
(E) a copy of the sanction work order shall be available for public
inspection at the worksite;
(F) measurement record of each work and details of the workers shall be
available for public inspection;
(G) D Citizens’ Information Board shall be put up at every worksite and
updated regularly in the manner specified by the Central Government;
(H) Whe vigilance and Monitoring Committee set up according to the
instructions of the Central Government may check all works and its evaluation
report will be recorded in the Works Register in the format specified by the
Central Government and submitted to the Gram Sabha during the Social
AXGLW
() The facilities of safe drinking water, shade for children and periods of rest,
first aid box with adequate material for emergency treatment for minor injuries and
other health hazards connected with the work being performed shall be provided at
WKHZRUNVLWH
() In case the number of children below the age of five years accompanying
the women working at any site is five or more, provisions shall be made to depute
RQHRIVXFKZRPHQZRUNHUVWRORRNDIWHUVXFKFKLOGUHQ7KHSHUVRQVRGHSXWHGVKDOO
EHSDLGZDJHUDWH
Welfare—() If any personal injury is caused to any person employed under
the Scheme by any accident arising out of and in the course of his employment, he
VKDOOEHHQWLWOHGWRVXFKPHGLFDOWUHDWPHQWDVUHTXLUHGIUHHRIFRVW
() Where hospitalisation of the injured worker is necessary, the State
Government shall arrange for such hospitalisation including accommodation,
treatment, medicines and payment of daily allowance which is not less than half of
WKHZDJHUDWH
() If a person employed under the Scheme meets with death or becomes
permanently disabled by accident arising out of and in the course of employment,
he or his legal heirs, as the case may be, shall be paid by the implementing agency
an H[JUDWLDas per entitlement under the 3UDGKDQ0DQWUL6XUDNVKD%LPD<RMDQD
RUDVPD\EHQRWLILHGE\WKH&HQWUDO*RYHUQPHQW
() If any personal injury is caused by accident to a child accompanying a
person who is employed under the Scheme, such person shall be entitled to medical
treatment free of cost; and in case of death or disablement of the child due to the
said accident, H[JUDWLD shall be paid to the legal guardians as determined by the
6WDWH*RYHUQPHQW
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 29
:DJHSD\PHQW—() In case the payment of wages is not made within fifteen
days from the date of closure of the muster roll, the wage seekers shall be entitled
WRUHFHLYHSD\PHQWRIFRPSHQVDWLRQIRUWKHGHOD\DWWKHUDWHRIRIWKHXQSDLG
ZDJHVSHUGD\RIGHOD\EH\RQGWKHVL[WHHQWKGD\RIFORVXUHRIPXVWHUUROO
()Any delay in payment of compensation beyond a period of fifteen days
from the date it becomes payable, shall be considered in the same manner as the
delay in payment of wages
()For the purpose of ensuring accountability in payment of wages and to
calculate culpability of various functionaries or agencies, the States shall divide
the processes leading to determination and payment of wages into various stages
such as,—
(D) measurement of work;
(E) computerising the muster rolls;
(F) computerising the measurements;
(G) generation of wage lists; and
(H) uploading Fund Transfer Orders (FTOs), and specify stage-wise
maximum time limits along with the functionary or agency which is
UHVSRQVLEOHIRUGLVFKDUJLQJWKHVSHFLILFIXQFWLRQ
() The computer system shall have a provision to automatically calculate the
compensation payable based on the date of closure of the muster roll and the date of
GHSRVLWRIZDJHVLQWKHDFFRXQWVRIWKHZDJHVHHNHUV
() The State Government shall pay the compensation upfront after due
verification within the time limits as specified above and recover the compensation
amount from the functionaries or agencies who are responsible for the delay in
payment
() It shall be the duty of the District Programme Coordinator or Programme
2IILFHUWRHQVXUHWKDWWKHV\VWHPLVRSHUDWLRQDOLVH
() The number of days of delay, the compensation payable and actually paid
shall be reflected in the Management Information System
() Effective implementation of sub-paragraph () shall be considered
QHFHVVDU\IRUWKHSXUSRVHVRIVHFWLRQ RIWKH$FW
7KH SD\PHQW RI ZDJHV VKDOO XQOHVV VR H[HPSWHG E\ WKH &HQWUDO
Government, be made through the individual savings accounts of the workers in the
UHOHYDQW%DQNVRU3RVW2IILFHV
,Q FDVH RI HPSOR\PHQW SURYLGHG XQGHU WKH 6FKHPH WKHUH VKDOO EH QR
discrimination solely on the ground of gender and the provisions of the Equal
5HPXQHUDWLRQ$FW RI VKDOOEHFRPSOLHGZLWK
5HFRUGPDLQWHQDQFHDQGJULHYDQFHUHGUHVVDO system—The Gram Panchayat
shall prepare and maintain or cause to be prepared and maintained such registers,
vouchers and other documents in such form and in such manner as may be specified
in the Scheme containing particulars of Gramin Rozgar Guarantee Cards and pass
books issued, name, age and address of the head of the household and the adult
PHPEHUVRIWKHKRXVHKROGVUHJLVWHUHGZLWKWKH*UDP3DQFKD\DW
) Notwithstanding anything contained in this Schedule, in the event of
any national calamity such as flood, cyclone, tsunami and earthquake resulting in
mass dislocation of rural population, the adult members of rural households of areas
so affected may—
30 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-37
(D) seek for registration and get *UDPLQRozgar Guarantee Card issued
by the Gram Panchayat or Programme Officer of the area of temporary
relocation;
(E) submit written or oral applications for work to the Programme
Officer or the Gram Panchayat of the area of temporary relocation; and
(F) apply for re-registration and re-issuance of Gramin Rozgar Guarantee
Card in the event of any loss or GHVWUXFWLRQ
() The details of such Gramin Rozgar Guarantee Cards shall be intimated to
WKH'LVWULFW3URJUDPPH&RRUGLQDWRU
() In the event of restoration of normalcy, the Gramin Rozgar Guarantee Card
so issued shall be re-endorsed at original place of habitation and clubbed with the
original Gramin 5R]JDU*XDUDQWHH&DUGRQEHLQJUHWULHYHG
() The number of days of employment provided shall be counted while
FRPSXWLQJGD\VRIJXDUDQWHHGHPSOR\PHQWSHUKRXVHKROG
(YHU\ZRUNHUVKDOOKDYHDQRSSRUWXQLW\RIEHLQJKHDUGDQGUHJLVWHUDQ\
grievance either orally or in writing, at all implementation levels for disposal as per
the provisions of the GrievancH5HGUHVVDO0HFKDQLVPXQGHUWKH6FKHPH
'55$-,90$1,
Secretary to the Govt. of India.
Sd/-
No. 11-37] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 31
MINISTRY OF LAW AND JUSTICE
/HJLVODWLYH'HSDUWPHQW
New Delhi, the 21st December, 2025/Agrahayana 30, 1947 (Saka)
The following Act of Parliament received the assent of the President on the
20th December, 2025 and is hereby published for general information:—
THE REPEALING AND AMENDING ACT, 2025
1ඈඈൿ
[20th December,@
$Q$FWWRUHSHDOFHUWDLQHQDFWPHQWVDQGWRDPHQGFHUWDLQRWKHUHQDFWPHQWV
BE it enacted by Parliament in the Seventy-sixth Year of the Republic of
India as follows:––
1 7KLV$FWPD\EHFDOOHGWKH5HSHDOLQJDQG$PHQGLQJ$FW
2 7KHHQDFWPHQWVVSHFLILHGLQWKH)LUVW6FKHGXOHDUHKHUHE\UHSHDOHG
3 7KHHQDFWPHQWVVSHFLILHGLQ the Second Schedule are hereby amended to
the extent and in WKHPDQQHUPHQWLRQHGLQWKHIRXUWKFROXPQWKHUHRI
6KRUWWLWOH
Repeal of certain
HQDFWPHQWV
Amendment of
certain
HQDFWPHQWV
EXTRAORDINARY
REGD NO. JK–33
———————————————————————————————
Vol. 139
Srinagar, Thu., the 11th June, 2026/21st Jyai., 1948. [No. 11-38
———————————————————————————————
PART IV
Reprints from the Government of India Gazette.
———
6DYLQJV
4 7KHUHSHDOE\WKLV$FWRIDQ\HQDFWPHQWVKDOOQRWDIIHFWDQ\RWKHUHQDFWPHQW
in which the repealed enactment has been applied, incorporated or referred to;
and this Act shall not affect the validity, invalidity, effect or consequences of
anything already done or suffered, or any right, title, obligation or liability already
acquired, accrued or incurred, or any remedy or proceeding in respect thereof, or
any release or discharge of or from any debt, penalty, obligation, liability, claim or
demand, or any indemnity already granted, or the proof of any past act or thing;
nor shall this Act affect any principle or rule of law, or established jurisdiction,
form or course of pleading, practice or procedure, or existing usage, custom,
privilege, restriction, exemption, office or appointment, notwithstanding that the
same respectively may have been in any manner affirmed or recognised or derived
by, in or from any enactment hereby repealed;
nor shall the repeal by this Act of any enactment revive or restore any
jurisdiction, office, custom, liability, right, title, privilege, restriction, exemption,
XVDJHSUDFWLFHSURFHGXUHRURWKHUPDWWHURUWKLQJQRWQRZH[LVWLQJRULQIRUFH
2 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-38
7+(),567SCHEDULE
(See section 2)
REPEALS
Year
$FW1R
Short Title
1
2
3
1886
;,
7KH,QGLDQ7UDPZD\V$FW
1976
31
7KH/HY\6XJDU3ULFH(TXDOLVDWLRQ)XQG$FW
1978
41
The Britannia Engineering Company Limited (Mokameh Unit)
and the Arthur Butler and Company (Muzaffarpore) Limited
(Acquisition and Transfer of Undertakings) Act, 1978
1982
36
The
Chaparmukh-Silghat
Railway
Line
and
the
Katakhal-LaODED]DU5DLOZD\/LQH 1DWLRQDOLVDWLRQ$FW
1984
55
The Hooghly Docking and Engineering Company Limited
(Acquisition and 7UDQVIHURI8QGHUWDNLQJV$FW
1988
44
The Bharat Petroleum Corporation Limited (Determination of
&RQGLWLRQVRI6HUYLFHRI(PSOR\HHV$FW
2016
3
7KH$UELWUDWLRQDQG&RQFLOLDWLRQ $PHQGPHQW$FW
2017
1
The Payment of Wages $PHQGPHQW$FW
2017
3
7KH(QHP\3URSHUW\ $PHQGPHQWDQG9DOLGDWLRQ$FW
2017
6
7KH0DWHUQLW\%HQHILW $PHQGPHQW$FW
2017
11
The Employee’s Compensation (Amendment) Act, 2017.
2017
30
The Banking Regulation (Amendment) Act,
2018
7
The National Bank for Agriculture and Rural Development
(Amendment) Act, 2018
2018
10
The High Court and Supreme Court Judges (Salaries and
&RQGLWLRQVRI6HUYLFH$PHQGPHQW$FW
2018
12
The Payment of Gratuity (Amendment) Act,
2018
18
7KH6SHFLILF5HOLHI $PHQGPHQW$FW
2018
19
7KH6WDWH%DQNV 5HSHDODQG$PHQGPHQW$FW
2018
20
7KH1HJRWLDEOH,QVWUXPHQWV $PHQGPHQW$FW
2018
28
The Commercial Courts, Commercial Division and Commercial
$SSHOODWH'LYLVLRQRI+LJK&RXUWV $PHQGPHQW$FW
2019
15
7KH&HQWUDO8QLYHUVLWLHV $PHQGPHQW$FW
2019
19
7KH3URWHFWLRQRI+XPDQ5LJKWV $PHQGPHQW$FW
2019
27
The Airports Economic Regulatory Authority of India
$PHQGPHQW$FW
2019
32
7KH0RWRU9HKLFOHV $PHQGPHQW$FW
2019
38
7KH1DWLRQDO,QVWLWXWHRI'HVLJQ $PHQGPHQW$FW
2019
41
7KH&KLW)XQGV $PHQGPHQW$FW
2019
43
7KH6SHFLDO3URWHFWLRQ*URXS $PHQGPHQW$FW
2019
48
7KH$UPV $PHQGPHQW$FW
2020
1
7KH,QVROYHQF\DQG%DQNUXSWF\&RGH $PHQGPHQW$FW
2020
4
The Constitution (Scheduled Tribes) Order (Amendment)
$FW
2020
13
7KH$LUFUDIW $PHQGPHQW$FW
No. 11-38] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 3
1
2
3
2020
17
The Insolvency and Bankruptcy Code (Second Amendment)
Act, 2020
2020
18
The Salaries and Allowances of Ministers (Amendment)
$FW
2020
24
7KH+RPRHRSDWK\&HQWUDO&RXQFLO $PHQGPHQW$FW
2020
25
The Indian Medicine Central Council (Amendment)
$FW
2020
39
The Banking Regulation $PHQGPHQW$FW
2021
3
7KH$UELWUDWLRQDQG&RQFLOLDWLRQ $PHQGPHQW$FW
2021
6
7KH,QVXUDQFH $PHQGPHQW$FW
2021
8
The Medical Termination of Pregnancy (Amendment) $FW
2021
15
The Government of National Capital Territory of Delhi
$PHQGPHQW$FW
2021
21
7KH)DFWRULQJ5HJXODWLRQ $PHQGPHQW$FW
2021
22
7KH&RFRQXW'HYHORSPHQW%RDUG $PHQGPHQW$FW
2021
26
The Insolvency and Bankruptcy CoGH $PHQGPHQW$FW
2021
27
The Central Universities (Amendment) Act,
2021
28
The Airports Economic Regulatory Authority of India
$PHQGPHQW$FW
2021
30
The Deposit Insurance and Credit Guarantee Corporation
$PHQGPHQW$FW
2021
32
The Constitution (Scheduled Tribes) Order (Amendment)
$FW
2021
37
The
General
Insurance
Business
(Nationalisation)
$PHQGPHQW$FW
2021
38
The National Commission for Indian System of Medicine
$PHQGPHQW$FW
2021
39
The National Commission for Homoeopathy (Amendment)
Act,
2021
43
The National Institute of Pharmaceutical Education and
5HVHDUFK $PHQGPHQW$FW
2021
44
The High Court and Supreme Court Judges (Salaries and
&RQGLWLRQVRI6HUYLFH$PHQGPHQW$FW
2021
49
The Election Laws $PHQGPHQW$FW
2022
8
The Constitution (Scheduled Castes and Scheduled Tribes)
2UGHUV $PHQGPHQW$FW
2022
9
The Constitution (Scheduled Tribes) Order (Amendment)$FW
2022
10
The Delhi Municipal Corporation (Amendment) Act,
2022
14
The Weapons of Mass Destruction and their Delivery Systems
3URKLELWLRQRI8QODZIXO$FWLYLWLHV$PHQGPHQW$FW
2022
19
7KH(QHUJ\&RQVHUYDWLRQ $PHQGPHQW$FW
4 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-38
1
2
3
2022
20
The Constitution (Scheduled Castes and Scheduled Tribes)
2UGHUV 6HFRQG$PHQGPHQW$FW
2022
23
The New Delhi International Arbitration Centre (Amendment)
$FW
2023
1
The Constitution (Scheduled Tribes) Order (Second
$PHQGPHQW$FW
2023
2
The
Constitution
6FKHGXOHG
7ULEHV
2UGHU
)RXUWK
$PHQGPHQW$FW
2023
9
TKH&RPSHWLWLRQ $PHQGPHQW$FW
2023
11
The Multi-State Co-operative Societies (Amendment)
$FW
2023
12
7KH&LQHPDWRJUDSK $PHQGPHQW$FW
2023
13
The Constitution (Scheduled Tribes) Order (Amendment)
$FW
2023
14
The Constitution (Scheduled Tribes) Order (Second
$PHQGPHQW$FW
2023
16
The Mines and Minerals (Development and Regulation)
$PHQGPHQW$FW
2023
17
The Offshore Areas Mineral (Development and Regulation)
$PHQGPHQW$FW
2023
19
The Government of National Capital Territory of Delhi
$PHQGPHQW$FW
2023
27
7KH&RDVWDO$TXDFXOWXUH$XWKRULW\ $PHQGPHQW$FW
2023
36
The Central Universities $PHQGPHQW$FW
No. 11-38] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 5
THE SECOND SCHEDULE
(See section 3)
AMENDMENTS
Year
Act
1R
Short Title
Amendments
1
2
3
4
1897
10
The General Clauses
$FW
In section 27, for the words “registered
post”,
the
words
“speed
post
with registration” shall be substituted.
1908
5
The Code of Civil
3URFHGXUH
L In section 148A, in sub-section (2),
for
the
words
“registered
post,
acknowledgement due”, the words “speed
post with registration and proof of delivery”
shall be substituted;
LL In the )LUVW Schedule,±±
D LQ2UGHU9LQrule 9,––
(,)
in sub-rule (3), for the
words
“registered
post
acknowledgement due, addressed to
the
defendant
or
his
agent
empowered to accept the service or
by speed post”, the words “speed
post
with
registration
and
proof
of
delivery
addressed
to
the
defendant or his agent empowered
to
accept
the service” shall be
substituted;
(,,)
in
sub-rule
(4),
the
brackets and words “(except
by
registered
post
acknowledgment
due)”
shall
be omitted;
(,,,)
in
sub-rule
(5),
in the
proviso,
for
the
words
“registered
post acknowledgement
due,
the declaration
referred
to
in
this
sub-rule
shall
be
made
notwithstanding the
fact
that
the
acknowledgement”, the words “speed
post with registration and proof of
delivery, the declaration referred to
in
this
sub-rule
shall
be made
notwithstanding
the
fact
that
the
proof of delivery” shall be substituted;
ELQ2UGHU;;,LQUXOHLQsub-rule (2),for
the
words
“registered post,
acknowledgement
due”,
the
words
“speed post with registration and proof of
delivery” shall be substituted; and
(F) Ln 2UGHU ;;;,; in rule 3,
in the proviso,
in
clause
(a),
for
the words “registered post”, the
words “speed post with registration”
shall be substituted.
6 The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. [No. 11-38
1
2
3
4
1925
39
The
Indian
Succession
Act,
(i) In section 3, in sub-section (1), the
figures “, 213” shall be omitted;
(ii) section 213 shall be omitted;
(iii) in section 370,––
(a) in sub-section (1), for the
words and figures “or section 213 to be
established by letters of administration
or probate”, the words “to be
established
by
letters
of
administration” shall be substituted;
(b) in sub-section (2), clause (b)
VKDOOEHRPLWWHG
2005
53
The
Disaster
Management Act,
In section 30, in sub-section (2), in
clause (vi), for the word “prevention”, the
word “preparation” shall be substituted.
'55$-,90$1,
Secretary to the Govt. of India.
Sd/-
No. 11-38] The J&K Official Gazette, the 11th June, 2026/21st Jyai., 1948. 7